RetrogeneDB ID:
retro_ecab_616
Organism:
Horse ( Equus_caballus )
Location:
23:23141938-23142129 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
63.08 %
Coverage:
53.78 %
Frameshifts:
1
Stop codons:
1


Parental gene:
Parental gene symbol:
YPEL2
Parental gene aliases:
No gene alias available
Parental gene description:
yippee-like 2 (Drosophila) [Source:HGNC Symbol;Acc:18326]

Genomic region (view in browser)





>retro_ecab_616
ATGATAAAAATGACAAACTCAAAAACTTGCCAAGGGTATCTGCCAAATTGTCCTTGAATT
TACTGCTGTATCCACTGGAAAGCCCATTTAGCAAATCCTGCTGTGTTGATCTCCAAGTCC
TTTCATGTTAGTCAACATCAAGCCCACCTCTTTAATTCTGTGTGAAGGTGGCCTGTGGTC
CAGGAGAGGAC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MVKMTRSKTFQAYLPSCHRTYSCIHCRAHLANHDELISKSFQGSQGRAYLFNSV-VNVGCGPAEE
M.KMT.SKT.Q.YLP.C...Y.CIH..AHLAN...LISKSF..SQ..A.LFNSV.V.V.CGP.E.
Retrocopy
MIKMTNSKTCQGYLPNCP*IYCCIHWKAHLANPAVLISKSFHVSQHQAHLFNSV/VKVACGPGED


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide