RetrogeneDB ID:
retro_ecab_617
Organism:
Horse ( Equus_caballus )
Location:
23:28670032-28670673 (-)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
82.95 %
Coverage:
100.0 %
Frameshifts:
1
Stop codons:
2


Parental gene:
Parental gene symbol:
PPIB
Parental gene aliases:
No gene alias available
Parental gene description:
peptidyl-prolyl cis-trans isomerase B [Source:RefSeq peptide;Acc:NP_001093231]

Genomic region (view in browser)





>retro_ecab_617
ATGCCGCATTTCTCAGAGCCGAATATGAAGGTGTTCTTTGCTGCCGCCCTTATCAAGGGC
TCAGTCTTTTTCCTGCTGTTGTCAGGACCCTCCACGGCTGATGAGAAGGGACCCAAAGTC
ACTGTCAAGGTGTGCATTGATCTGAGAATTGGAGGTAAAGATCAGGCTGGATGGTCATTG
GTCTCTTTGGAAAGACTCTTCCAAAAACCCTGGATAATTTTGTGGCCTTAGCCACAAGAT
AGAAAGGATTTGGGTACAAAGACAGCAAATTCCATCATGTGAGCAAGGACGTCACGATCC
AGGGTGGAGACTTCACCCGGGGAGATGGCACTGGAGGTAAGAGCATCTAAGGTGAAGGCT
TCTTGGATGAGAACTTCAAGCTGAAACACTATGGGCCCGGCTGGGTAAGCATGGCCAACA
CAGGCAAAGACTCCAACGGCTCCCAAGTCTTTATCACGACAGTCAAGACAGCCTGGCTAG
ATGGCAAGCACATCGTGTTCGGCAAAGTTCTTCAGGGCATGGAGGTAGTGCGGAAGGTGG
CGAGAGCCAAGACAGATGGTCAGGACAAGCCCCTGAAGGATGTGACAATCGCAGACTGCG
GCAAGATCCAGGTGGAGAAGCCCTTTGCCATCGCCAAGGAG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.09
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MLRFSERNMKVLFAAALIVGSVFFLLLPGPSTADEKKKGPKVTVKVYFDLRIGDED-IGRVVIGLFGKTVPKTVDNFVALATGEKGFGYKDSKFHRVIKD
M..FSE.NMKV.FAAALI.GSVFFLLL.GPSTADEK..GPKVTVKV..DLRIG..D..G..VIGLFGKT.PKT.DNFVALAT..KGFGYKDSKFH.V.KD
Retrocopy
MPHFSEPNMKVFFAAALIKGSVFFLLLSGPSTADEK--GPKVTVKVCIDLRIGGKD/SGWMVIGLFGKTLPKTLDNFVALATR*KGFGYKDSKFHHVSKD


Parental protein
FMIQGGDFTRGDGTGGKSIYGERFPDENFKLKHYGPGWVSMANAGKDTNGSQFFITTVKTAWLDGKHVVFGKVLEGMEVVRKVETTKTDGRDKPLKDVTI
..IQGGDFTRGDGTGGKSI.GE.F.DENFKLKHYGPGWVSMAN.GKD.NGSQ.FITTVKTAWLDGKH.VFGKVL.GMEVVRKV...KTDG.DKPLKDVTI
Retrocopy
VTIQGGDFTRGDGTGGKSI*GEGFLDENFKLKHYGPGWVSMANTGKDSNGSQVFITTVKTAWLDGKHIVFGKVLQGMEVVRKVARAKTDGQDKPLKDVTI


Parental protein
ADCGKIEVEKPFAIAKE
ADCGKI.VEKPFAIAKE
Retrocopy
ADCGKIQVEKPFAIAKE


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide