RetrogeneDB ID:
retro_ecab_619
Organism:
Horse ( Equus_caballus )
Location:
23:35288485-35288804 (-)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
72.48 %
Coverage:
55.73 %
Frameshifts:
2
Stop codons:
1


Parental gene:
Parental gene symbol:
RAC2
Parental gene aliases:
No gene alias available
Parental gene description:
ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2) [Source:HGNC Symbol;Acc:9802]

Genomic region (view in browser)





>retro_ecab_619
GCCACTAAGGGTGTGGCGGTGGGAGATGGAGCAGTTGGCAAAATTTGTGTACTGACCAGT
TACACAACCAATGCATTTCCTGGGGAATATAGCCCACTGTCTTTGACAGCTATTCTGCCA
ATGTTACGGTAGATGGAAAACCAGTGAATCTGGGCTTATGGATACAGCCGGACAAGAAGA
TGAGGACAGATCATGCCTCCTATCCTATCCGCAAATAGGTGTATTCTTAATTTGCCTTTC
TCTTCTGAGTCTTGCCTAACTCGAAAATGCCCGTGCAAAGTGGTGTCTGGAAGTGCAACA
TCATCCAGAGTCCCAACCC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
AIKCVVVGDGAVGKTCLLISYTTNAFPGEYIP-TVFDNYSANVMVDSKPVNLGLW-DTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWYPE
A.K.V.VGDGAVGK.C.L.SYTTNAFPGEY.P.TVFD.YSANV.VD.KPVNLGLW.DTAGQED.DR...LSYPQ..VFLIC.SL.S.A..EN.RAKW..E
Retrocopy
ATKGVAVGDGAVGKICVLTSYTTNAFPGEYSP/TVFDSYSANVTVDGKPVNLGLW/DTAGQEDEDRSCLLSYPQIGVFLICLSLLSLA*LENARAKWCLE


Parental protein
VRHHCPSTP
V.HH..S.P
Retrocopy
VQHHPESQP


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide