RetrogeneDB ID:
retro_ecab_62
Organism:
Horse ( Equus_caballus )
Location:
X:81739381-81740221 (-)
Status:
KNOWN_PROTEIN_CODING
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
79.84 %
Coverage:
77.88 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
MORF4L1
Parental gene aliases:
No gene alias available
Parental gene description:
mortality factor 4 like 1 [Source:HGNC Symbol;Acc:16989]

Genomic region (view in browser)





>retro_ecab_62
NCTCGTGGACAACAATCTGCAGAAGAAGACAACTTCAAAAAACCAACTAGAAGCAATATG
CAGAGAAGTAAGATGAGAGGGGCCTCCTCAGGAAAGAAGACAGCTGGTCCACAGCAGAAG
AATCTGGAACCGGCTCTCCCTGGCAGGTGGGGGGGTCGCTCTGCGGAGAACCCGCCTTCA
GGATCTGTGAGGAAGACAAGAAAGAACAAACAGAAGACTCCTGGAAACGGAGATGGTGGC
AGTACCAGCGAAGCACCTCAGCCACCTCGGAAGAAAAGGGCCCGGGCAGACCCCACCGTT
GAAAGTGAAGAGGTGTTTAAGAATAGAATGGAAGTTAAAGTGAAGATTCCTGAAGAATTA
AAACCATGGCTTGTCGAGGACTGGGACTTAGTTACCAGGCAGAAGCAGCTGTTTCAACTC
CCTGCTAAGAAAAATGTAGATGCCATTCTGGAAGAGTATGCAGATTGCAAGAAGTCGCAG
GGAAATGTCGATAATAAGGAATATGCGGTTAATGAAGTCGTGGCAGGAATAAAAGAATAT
TTCAACGTGATGTTGGGCACTCAGCTGCTCTACAAATTTGAGAGGCCCCAGTATGCTGAA
ATCCTCTTGGCTCACCCTGATGCGCCGATGTCCCAGGTTTATGGAGCGCCACACCTACTG
AGATTATTCGTAAGAATCGGAGCAATGTTGGCATATACGCCCCTTGATGAGAAGAGCCTT
GCATTATTGTTGGGCTATTTGCATGATTTCCTAAAATATCTGGCAAAGAATGCTGCGTCT
CTGTTTACTGCCAGTGATTACAAGGTGGCTTCGGCTGAGTACCACCGCAAAGCCCTGTGA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 59.47
SRP021940_cerebellum 55.86
SRP021940_embryo 109.34
SRP021940_placental_villous 102.84
SRP021940_synovial_membrane 53.29
SRP021940_testis 45.69

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
QEQYAEGKMRGAAPGKKTSGLQQKNVEVKTKKNKQKTPGNGDGGSTSETPQPPRKKRARVDPTVENEETFMNRVEVKVKIPEELKPWLVDDWDLITRQKQ
Q....E....G...G..........V..KT.KNKQKTPGNGDGGSTSE.PQPPRKKRAR.DPTVE.EE.F.NR.EVKVKIPEELKPWLV.DWDL.TRQKQ
Retrocopy
QQKNLEPALPGRWGGRSAENPPSGSVR-KTRKNKQKTPGNGDGGSTSEAPQPPRKKRARADPTVESEEVFKNRMEVKVKIPEELKPWLVEDWDLVTRQKQ


Parental protein
LFYLPAKKNVDSILEDYANYKKSRGNTDNKEYAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILADHPDAPMSQVYGAPHLLRLFVRIGAMLAYTPLD
LF.LPAKKNVD.ILE.YA..KKS.GN.DNKEYAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEIL..HPDAPMSQVYGAPHLLRLFVRIGAMLAYTPLD
Retrocopy
LFQLPAKKNVDAILEEYADCKKSQGNVDNKEYAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILLAHPDAPMSQVYGAPHLLRLFVRIGAMLAYTPLD


Parental protein
EKSLALLLNYLHDFLKYLAKNSATLFSASDYEVAPPEYHRKAV
EKSLALLL.YLHDFLKYLAKN.A.LF.ASDY.VA..EYHRKA.
Retrocopy
EKSLALLLGYLHDFLKYLAKNAASLFTASDYKVASAEYHRKAL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide