RetrogeneDB ID:
retro_ecab_621
Organism:
Horse ( Equus_caballus )
Location:
23:39153893-39154494 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
67.8 %
Coverage:
66.56 %
Frameshifts:
2
Stop codons:
3


Parental gene:
Parental gene symbol:
KIAA1191
Parental gene aliases:
No gene alias available
Parental gene description:
KIAA1191 [Source:HGNC Symbol;Acc:29209]

Genomic region (view in browser)





>retro_ecab_621
GTGGACAAGGTCCCAGTGGTGAAGGCTAGAGCCACCTACGTCATCAGGAATTCTCCAATC
ACAAAGCAGACTCAGAAGAACATACAGTGTTTAGAGCAAAGAGCAGGGCTGAGAAATGCT
GGCTGCACACCTCACAGAGGTCTTCCCACCGAGGAGACGAAGTACCGTTGAGTGGCAGAA
GCACACCACACACTAAAGCTGCACAGTGAAGAGATGACAAAAGAAGAGAGGCAGCCTGCA
TCAGCCCAGTCCACTCTGAGCAGCATCCCCCACTCTTCCCCTAAGCAGAAGCCCCGAGGC
TGGTACACCTCTGGTTCTTCCACTGCCTGACCTGGCCCAATCCCAGCACCATGGATTCTG
GAAGTGGAGATAAGGACAGAAACTCATCAGATAAATGGAGCTTCTTGGAACCAAGACTCC
TCCAGAGTCTGATTCAGTTTTGCCACCCAGGCTACCAAGGGGCCAAGAAGCCCTCTCCAA
TGGAACTGATCCAGATCCAGGCCACCTGAATGGTGAGGATCCAGCAACCATCAGGCCACT
CAAGGTGGACATCTCAGTGATGGAAGGGAAGAAACAATTGCCGCAGACACATTGTCTCAG
A

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
VDKVPVVKAKATRVIMNSLITKQTQESIQRFEQQAGLTDAGYTPHKGLTTEEIKYLRVAEALHKLKLQSGEITREEKQPASAQSTPGSTPHSSPKQKSRG
VDKVPVVKA.AT.VI.NS.ITKQTQ..IQ..EQ.AGL..AG.TPH.GL.TEE.KY..VAEA.H.LKL.S.E.T.EE.QPASAQST..S.PHSSPKQK.RG
Retrocopy
VDKVPVVKARATYVIRNSPITKQTQKNIQCLEQRAGLRNAGCTPHRGLPTEETKYR*VAEAHHTLKLHSEEMTKEERQPASAQSTLSSIPHSSPKQKPRG


Parental protein
WFASGSSTALPG-PNLSTMDSGSGDKDRNMADKWSFFGPRSLQKSDSGGFATQTYRGAQKPSPMDLIRAQATRM-AEDPATFKPPKMDIPVIEGKKQPPR
W..SGSSTA.PG.PN.STMDSGSGDKDRN..DKWSF..PR.LQ......F....Y.GA.KPSPM.LI..QAT.M..EDPAT..P.K.DI.V.EGKKQ.P.
Retrocopy
WYTSGSSTA*PG/PNPSTMDSGSGDKDRNSSDKWSFLEPRLLQSLIQ--FCHPGYQGAKKPSPMELIQIQAT*M/GEDPATIRPLKVDISVMEGKKQLPQ


Parental protein
THNLK
TH.L.
Retrocopy
THCLR


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide