RetrogeneDB ID:
retro_ecab_622
Organism:
Horse ( Equus_caballus )
Location:
23:40217664-40219548 (-)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
91.41 %
Coverage:
96.03 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
KLHL13
Parental gene aliases:
No gene alias available
Parental gene description:
kelch-like family member 13 [Source:HGNC Symbol;Acc:22931]

Genomic region (view in browser)





>retro_ecab_622
CCCCTGCCTCCGGCGTACGTCTTTGTGCAAGAGGAAAGCTTTCACATGAAAGTGTCTCTT
GGTAACGGCGATATGGGCGTCTCTGCCCATTTGCAGCCTTGCAAAGCAGGAACCACACGT
TTCTTTACCAGCAATACTCACAGTTCGGTGGTGTTGCAAGGCTTTGATCAGCTTAGAATA
GAAGGATTGCTTTGTGATGTGACTCTGGTCCCGGGTGATGGAGATGAAATCTTCCCTGTT
CACAGAGCTATGATGGCATCTGCTAGTGATTATTTCAAGGCTATGTTCACAGGGGGAATG
AAAGAACAAGATTTAATGTGCATTAAGCTTCATGGAGTGAACAAGGTTGGTCTGAAGAAA
ATAATTGATTTTATTTATACTGCAAAACTTTCTCTTAATATGGACAATCTTCAGGACACA
CTTGAAGCTGCCAGCTTTTTACAAATTTTACCTGTTTTGGATTTCTGTAAAGTGTTTCTT
ATTTCAGGAGTCTCTTTAGATAACTGTGTTGAAGTTGGGCGAATTGCTAACACCTATAAT
CTCATAGAAGTGGATAAATATGTCAATAATTTCATCCTGAAGAATTTTCCTGCGTTATTG
AGTACTGGGGAGTTTCTAAAACTCCCTTTTGAACGGCTCGCCTTTGTGCTTTCCAGCAAT
AGTCTTAAGCACTGTACCGAACTCGAGCTGTTCAAGGCTGCCTGTCGCTGGCTAAGGTTG
GAAGACCCTCGGATGGAATGTGCTGCAAAATTAATGAAGAATATTCGATTTCCACTGATG
ACACCACAGGACCTCATCAATTATGTGCAGACAGTAGATTTCATGAGAACAGACAATACC
TGTGTGAATTTGCTTTTGGAAGCCAGCAATTACCAAATGATGCCGTATATGCAACCAGTG
ATGCAGTCAGATAGAACTGCCATTCGATCTGACTCAACGCACTTGGTTACATTAGGAGGA
GTTTTGAGGCAGCAGCTGGTTGTCAGTAAAGAATTACGGATGTATGATGAAAGGGCACAA
GAGTGGAGATCTTTAGCCCCCATGGATGCTCCTCGTTACCAGCATGGCATTGCTGTCATT
GGAAACTTTCTTTATGTAGTTGGTGGTCAAAGTAATTACGATACGAAAGGAAAAACTGCC
GTCGATACAGTTTTCAGATTTGATCCTCGGTATAATAAATGGATGCAGGTTGCATCATTA
AATGAAAAGCGCACATTCTTCCACTTGAGTGCCCTCAAAGGACATTTGTATGCTGTTGGT
GGGCGAAGTGCAGCTGGTGAACTGGCTACAGTAGAATGTTACAACCCAAGAATGAATGAG
TGGAGTTATGTCGCAAAAATGTGCGAACCCCACTATGGCCATGCTGGAACAGTGTATGGA
GGCTTAATGTATATTTCAGGAGGAATTACTCACGACACTTTCCAAAACGAGCTCATGTGT
TTTGACCCAGATACAGACAAATGGACACAAAAGGCTCCAATGACTACAGTCAGAGGTCTG
CATTGCATGTGTACAGTTGGAGACAAGCTCTATGTCATTGGTGGCAATCACTTCAGAGGA
ACAAGTGATTATGATGATGTTCTAAGCTGTGAATACTATTCGCCGACCCTTGACCAGTGG
ACACCAATTGCTGCTATGTTAAGAGGTCAAAGTGATGTTGGAGTTGCTGTCTTTGAAAAT
AAAATCTATGTTGTAGGTGGATATTCTTGGAATAATCGTTGTATGGTTGAAATTGTCCAG
AAATATGACCCAGAAAAGGATGAGTGGCATAAAGTTTTTGACCTTCCAGAGTCACTTGGT
GGCATTCGAGCTTGTACTCTCACAGTTTTTCCACCTGAAGAAAACCCTGGGTCACCTTCT
AGAGAGTCACCTCTTTCAGCACCT

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 22.94
SRP021940_cerebellum 39.88
SRP021940_embryo 49.35
SRP021940_placental_villous 19.72
SRP021940_synovial_membrane 22.01
SRP021940_testis 9.26

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
PLSPAYISLVEEEDQHMKLSLGSSEMGLSSHLQSSKAGATRIFTSNTHSSVVLQGFDQLRLEGLLCDVTLMPGDTDDAFPVHRVMMASASDYFKAMFTGG
PL.PAY...V.EE..HMK.SLG...MG.S.HLQ..KAG.TR.FTSNTHSSVVLQGFDQLR.EGLLCDVTL.PGD.D..FPVHR.MMASASDYFKAMFTGG
Retrocopy
PLPPAYV-FVQEESFHMKVSLGNGDMGVSAHLQPCKAGTTRFFTSNTHSSVVLQGFDQLRIEGLLCDVTLVPGDGDEIFPVHRAMMASASDYFKAMFTGG


Parental protein
MKEQDLMCIKLHGVSKVGLRKIIDFIYTAKLSLNMDNLQDTLEAASFLQILPVLDFCKVFLISGVTLDNCVEVGRIANTYNLTEVDKYVNSFVLKNFPAL
MKEQDLMCIKLHGV.KVGL.KIIDFIYTAKLSLNMDNLQDTLEAASFLQILPVLDFCKVFLISGV.LDNCVEVGRIANTYNL.EVDKYVN.F.LKNFPAL
Retrocopy
MKEQDLMCIKLHGVNKVGLKKIIDFIYTAKLSLNMDNLQDTLEAASFLQILPVLDFCKVFLISGVSLDNCVEVGRIANTYNLIEVDKYVNNFILKNFPAL


Parental protein
LSTGEFLKLPFERLAFVLSSNSLKHCTELELFKATCRWLRLEEPRMDFAAKLMKNIRFPLMTPQELINYVQTVDFMRTDNTCVNLLLEASNYQMMPYMQP
LSTGEFLKLPFERLAFVLSSNSLKHCTELELFKA.CRWLRLE.PRM..AAKLMKNIRFPLMTPQ.LINYVQTVDFMRTDNTCVNLLLEASNYQMMPYMQP
Retrocopy
LSTGEFLKLPFERLAFVLSSNSLKHCTELELFKAACRWLRLEDPRMECAAKLMKNIRFPLMTPQDLINYVQTVDFMRTDNTCVNLLLEASNYQMMPYMQP


Parental protein
VMQSDRTAIRSDTTHLVTLGGVLRQQLVVSKELRMYDEKAHEWKSLAPMDAPRYQHGIAVIGNFLYVVGGQSNYDTKGKTAVDTVFRFDPRYNKWMQVAS
VMQSDRTAIRSD.THLVTLGGVLRQQLVVSKELRMYDE.A.EW.SLAPMDAPRYQHGIAVIGNFLYVVGGQSNYDTKGKTAVDTVFRFDPRYNKWMQVAS
Retrocopy
VMQSDRTAIRSDSTHLVTLGGVLRQQLVVSKELRMYDERAQEWRSLAPMDAPRYQHGIAVIGNFLYVVGGQSNYDTKGKTAVDTVFRFDPRYNKWMQVAS


Parental protein
LNEKRTFFHLSALKGYLYAVGGRNAAGELPTVECYNPRTNEWTYVAKMSEPHYGHAGTVYGGVMYISGGITHDTFQKELMCFDPDTDKWIQKAPMTTVRG
LNEKRTFFHLSALKG.LYAVGGR.AAGEL.TVECYNPR.NEW.YVAKM.EPHYGHAGTVYGG.MYISGGITHDTFQ.ELMCFDPDTDKW.QKAPMTTVRG
Retrocopy
LNEKRTFFHLSALKGHLYAVGGRSAAGELATVECYNPRMNEWSYVAKMCEPHYGHAGTVYGGLMYISGGITHDTFQNELMCFDPDTDKWTQKAPMTTVRG


Parental protein
LHCMCTVGERLYVIGGNHFRGTSDYDDVLSCEYYSPILDQWTPIAAMLRGQSDVGVAVFENKIYVVGGYSWNNRCMVEIVQKYDPDKDEWHKVFDLPESL
LHCMCTVG..LYVIGGNHFRGTSDYDDVLSCEYYSP.LDQWTPIAAMLRGQSDVGVAVFENKIYVVGGYSWNNRCMVEIVQKYDP.KDEWHKVFDLPESL
Retrocopy
LHCMCTVGDKLYVIGGNHFRGTSDYDDVLSCEYYSPTLDQWTPIAAMLRGQSDVGVAVFENKIYVVGGYSWNNRCMVEIVQKYDPEKDEWHKVFDLPESL


Parental protein
GGIRACTLTVFPPEETTPSPSRESPLSAP
GGIRACTLTVFPPEE...SPSRESPLSAP
Retrocopy
GGIRACTLTVFPPEENPGSPSRESPLSAP


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide