RetrogeneDB ID:
retro_ecab_624
Organism:
Horse ( Equus_caballus )
Location:
23:46757372-46758101 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
71.43 %
Coverage:
100.0 %
Frameshifts:
7
Stop codons:
2


Parental gene:
Parental gene symbol:
YWHAZ
Parental gene aliases:
No gene alias available
Parental gene description:
tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide [Source:HGNC Symbol;Acc:12855]

Genomic region (view in browser)





>retro_ecab_624
ATGGATAAAAATAAGCCGGAACCAAAGCCAAACTGACCAAGCAGGCTCAGCAATATGATG
ACACGGCAGCCTGCAAGAAGTCTATAACTGAGCAAGGAGCTGAATTAGCCAATGACGAGA
ATCATCTTCTCTCAGTTACTTATAAAAAATGTAAGAAGTTGTAGGTCATTTTGGAGAGCC
ACCTCAAGTATTGAGCTAAAGAGAGAAGACGCTGAGAAAAAGCAACAGATGACTCATGAC
AACAGAAGGAAAATTGAGATCAAGCTTAGAGCACACCTGCAATGATGTACAATCTCTTTT
GGAAAAGATATCAATCCCAATGCTTCACAAGCAGAGAGCAAAATCTTCCATCTGAAAACG
AAAAGAGACTAATATCGTTACATGGCTGAGGTTGCTGCTGGTGAGGACAAGAAAGGGATT
GTGGATGGGTCACCAAAAGCATACAAAGAAGCTTTTGAAATTAGCAAAAAAGAAATGCAA
TGGACTCATCCTATTAGATTGGGTCTGGTCCTTAGTTCCCTGTGTTCTATTATGAGATCT
GAACTCCTCTGAGAAAGCCTGCTCTCTTGCAAAGACAGCTTTTGATGAAACCATTACTGA
ATTTGATACATTAAGCGAAGGGTCATACAAAGACGGCACCCTAATAGGCAATGACTGAGA
GGCAACTTGACATTGTGGACATGGGATACCCAAGGAGACAAAGCAGAAGCAGGAGAAAGA
GGGGAAAAT

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MDKNE-LVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAY-KNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELR-DICNDV
MDKN.....KAKL..QA..YDD.AAC.KS.TEQGAEL.N.E..LLSV.Y.KNV...R.S.WR..SSIE.K.E.AEKKQQM....R.KIE..LR...CNDV
Retrocopy
MDKNK/AGTKAKLTKQAQQYDDTAACKKSITEQGAELANDENHLLSVTY\KNVRSCR-SFWRATSSIELKREDAEKKQQMTHDNRRKIEIKLR\HTCNDV


Parental protein
LSLLEKFLIP-NASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALN-FSVFYYEI-LNSPEKACSLAKT
.SLLEK..IP.NASQAESK.F.LK.K.D.YRY.AEVAAG.DKKGIVD.S..AY.EAFEISKKEMQ.THPIRLGL.L..F.VFYYEI.LNS.EKACSLAKT
Retrocopy
QSLLEKISIP/NASQAESKIFHLKTKRD*YRYMAEVAAGEDKKGIVDGSPKAYKEAFEISKKEMQWTHPIRLGLVLS/FPVFYYEI/LNSSEKACSLAKT


Parental protein
AFDEAIAELDTLSEESYKDSTLI-MQLLRDNLTLWTSDTQGDEAEAGEGGEN
AFDE.I.E.DTLSE.SYKD.TLI..Q.LR.NLTLWT.DTQGD.AEAGE.GEN
Retrocopy
AFDETITEFDTLSEGSYKDGTLI/RQ*LRGNLTLWTWDTQGDKAEAGERGEN


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide