RetrogeneDB ID:
retro_ecab_625
Organism:
Horse ( Equus_caballus )
Location:
23:52499376-52499738 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
53.23 %
Coverage:
70.59 %
Frameshifts:
3
Stop codons:
1


Parental gene:
Parental gene symbol:
No gene symbol available
Parental gene aliases:
No gene alias available
Parental gene description:
No gene description available

Genomic region (view in browser)





>retro_ecab_625
AATAAAGCAAGACTTTCAACAAAGAGAGAAAATATGAGAAAGTACCCAATAGAAATCACA
GAGCTGAAGAATACAATAACTGAACTAAGAAACCCTCAATGGAGGGGTTCAACATGTATT
AGGTAAAGCCAAAAAAAGGATCAGTGGACTCAAAGACAGGGCAGCAGAGCTCAACCAGCC
AGAGGACCAAAAAGAAAAATGAACGAAAAAGAGTGAAGAAAGCTTGAGGGACTTGTGGTC
AACATCAAGGAGATCAATATGTGCATTATAGGAGTCCCAGAAGGAGAAGAGAGAGGGAAA
GGGCAGAAAACTTATTCAAGGAAATAACGGTTGGGAACTTTCCACACATGGGGAGAGAAA
CA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
HSGNFNKETDSIRKCQIEVTELKNTIPELTNTL-EGFNSRLDEAEERISELNDR-AELTQSEQQKEKRMKNTDNSLRELWD-NIKHANIRIIGVPEGEER
............RK..IE.TELKNTI.EL.N....G....L..A..RIS.L.DR.AEL.Q.E.QKEK..K....SLR.LW..NIK..N..IIGVPEGEER
Retrocopy
NKARLSTKRENMRKYPIEITELKNTITELRNPQ\GGVQHVLGKAKKRISGLKDRAAELNQPEDQKEK*TKKSEESLRDLWS/NIKEINMCIIGVPEGEER


Parental protein
DKG-AENLFVEIIQENFPNLRKET
.KG.AENLF.EI...NFP....ET
Retrocopy
GKG/AENLFKEITVGNFPHMGRET


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide