RetrogeneDB ID:
retro_ecab_627
Organism:
Horse ( Equus_caballus )
Location:
24:3540427-3541533 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
85.03 %
Coverage:
98.4 %
Frameshifts:
5
Stop codons:
3


Parental gene:
Parental gene symbol:
HERPUD1
Parental gene aliases:
No gene alias available
Parental gene description:
homocysteine-inducible, endoplasmic reticulum stress-inducible, ubiquitin-like domain member 1 [Source:HGNC Symbol;Acc:13744]

Genomic region (view in browser)





>retro_ecab_627
CTGGAGCTGAGCGGCGACCGCAGCTGGAGCGTGGCCGTCTCAAGGCTCCTCTGAGCCGCG
TCTACCCCGAGCGCCCGCGGCCAGAGGACCAGAGGTTAATTTATTCTGGGGAGCCGTTGT
TGGATCACCGGTGTCTTAGGGACTTGCTTCCAAAGCAGGAGAAACGGCACGTTTCGCATC
TGGTATGCAATGTGAAGAGTCCTTCCAAAATGCCAGAAACCACCGCGAAGGTTGCTGAAG
CCACAGAGCAGCCTACTGGTCTTAATCAGGGACAGTATTCTGGGGATTCGCCAAGTGATG
GTTTAAGGCAAAGGGAGGCTCTCCGGAACCTTTCTCCCTCTGGATAGGAGAACATCTCCA
GACCTGAAGCTGCCCAGCCGGCGTTCCAAGGCCGGGGGCCTGGTTTCTCGGGCTACACAA
CCTATGGGTGGCTGCAGCTCTCCTGGTTCTAGCAGACGGACGCACGGCAGTACTGCATGC
AGTATTCAGCGGCCACTGCTGCATCAGGGGCTTCTGTGCCCTCACCAAGTGCACAAGAGA
TACCTGTGGTCTCCGCTCCTGCTCCAGCAGCTCCCATTCACAACCAGTTTCCAGCGGAAA
ACCAGCCGGCCAATCAGAATGCTGCCCCTCAAGTGGGTGGTTAATGCTGGGGCCAATCAG
AATTTGCGGATGACCGCACAAGGTGGCCCTATTGTGGAAGATGATGATGAGATCAACCGA
GATTGGTTGGATTGGACCTATTCAGCAGCTATGTTTTCGGTTTTTCTCAGTATCCTCTAA
TTCTACTCCTCTCTCAGCAGATTCCTCATGGTCATGGGAGCCACCGTGGTTACGTACCTG
CATCACGTTGGACGGTTTCCATTTAGACAGAGGCCAGTTCAGAACTTCCCGAAGGATGGG
CCCCCTTATGAAGCTGTGAATCAGGACCCCTACAATAACTTACAGGAACGCCCTGACCCT
GAAATCGAAGATCCCAACCACGTTCCTCCAGACAAGGACGTTCTGGATGGCGTGCAGACC
AGCCCTTCATTTTATGAGCACAACCTGGCTTGTTTTCAAGACTCTTTGCCTCTCTTCTTC
CAGAAGGGCCCCCAGCTATAGCAAAC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.06
SRP021940_cerebellum 0.25
SRP021940_embryo 0.05
SRP021940_placental_villous 0.13
SRP021940_synovial_membrane 0.05
SRP021940_testis 0.12

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
LELSGDRS-SV-GRLKAHLSRVYPERPRPEDQRLIYSGKLLLDHQCLRDLLPKQEKRHVLHLVCNVKSPAKMPETSAKVAEAPEQPAGLNQGQYPGDSPG
LELSGDRS.SV.GRLKA.LSRVYPERPRPEDQRLIYSG..LLDH.CLRDLLPKQEKRHV.HLVCNVKSP.KMPET.AKVAEA.EQP.GLNQGQY.GDSP.
Retrocopy
LELSGDRSWSV/GRLKAPLSRVYPERPRPEDQRLIYSGEPLLDHRCLRDLLPKQEKRHVSHLVCNVKSPSKMPETTAKVAEATEQPTGLNQGQYSGDSPS


Parental protein
DGLRPREPLRNLSPSGWENISRPEAAQPAFQGLGPGFSGLTTYGWLQLSWLQQVYARQYYMQYLAATAASGAFVPSPSAQEIPVVSAPAPAAPIHNQFPA
DGLR.RE.LRNLSPSG.ENISRPEAAQPAFQG.GPGFSG.TTYGWLQLSW..Q..ARQY.MQY.AATAASGA.VPSPSAQEIPVVSAPAPAAPIHNQFPA
Retrocopy
DGLRQREALRNLSPSG*ENISRPEAAQPAFQGRGPGFSGYTTYGWLQLSWF*QTDARQYCMQYSAATAASGASVPSPSAQEIPVVSAPAPAAPIHNQFPA


Parental protein
ENQPANQNAAPQV-VVNPGANQNLRMNAQGGPVVEEDDELNRDWLDWTYSAATFSVFLSILYFYSSLSRFLMVMGATVVMYLHHVGWFPFRQRPVQNFPN
ENQPANQNAAPQV.VVN.GANQNLRM.AQGGP.VE.DDE.NRDWLDWTYSAA.FSVFLSIL.FYSSLSRFLMVMGATVV.YLHHVG.FPFRQRPVQNFP.
Retrocopy
ENQPANQNAAPQV\VVNAGANQNLRMTAQGGPIVEDDDEINRDWLDWTYSAAMFSVFLSIL*FYSSLSRFLMVMGATVVTYLHHVGRFPFRQRPVQNFPK


Parental protein
GGPPYDAVNQDPNNNLQEGPDPEIEDPSHGPPDRDALDGEQTSPS-FMSTAWLVFKTFFAS-LLPEGP-PAIAN
.GPPY.AVNQDP.NNLQE.PDPEIEDP.H.PPD.D.LDG.QTSPS.FMST.WLVFKT...S.....GP.PAIAN
Retrocopy
DGPPYEAVNQDPYNNLQERPDPEIEDPNHVPPDKDVLDGVQTSPS\FMSTTWLVFKTLCLS/FFQKGP/PAIAN


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide