RetrogeneDB ID:
retro_ecab_628
Organism:
Horse ( Equus_caballus )
Location:
24:11343111-11344650 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
86.8 %
Coverage:
79.29 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
HSPA8
Parental gene aliases:
No gene alias available
Parental gene description:
Heat shock cognate 71 kDa protein [Source:UniProtKB/Swiss-Prot;Acc:A2Q0Z1]

Genomic region (view in browser)





>retro_ecab_628
CCCGAGGAGATCTCCTCCATGGTCCTCACTAAGATGAAGGAGATCGCCGAAGCCTACCTG
GGGGGCAAAGTGCAGAGCGCGGTCATCACCGTCCCGGCCTATTTCAACGACTCGCAGCGC
CAGGCCACCAAGGACGCGGGCACCATCACCGGCCTCAACGTGCTGCGCATCATCAACGAG
CCCACGGCGGCGGCCATCGCCTACGGCCTGGACAAGAAGGGCTGCACGGGCGGCGAGAAG
AACGTGCTCATCTTTGACCTGGGCGGCGGCACCTTCGACGTGTCCATCCTGACCATCGAG
GACGGCATCTTCGAGGTGAAGTCCACGGCCGGCGACACCCACCTGGGCGGCGAGGACTTT
GACAACCGCATGGTGAGCCATCTGGCGGAGGAGTTCAAGCGCAAGCACAAGAAGGACATC
GCGCCCAACAAGCGCGCGGTGCGGCGGCTGCGCACGGCCTGCGAGCGCGCCAAGCGCACC
CTGAGCTCGTCCACGCAGGCGAGCATCGAGATCGACTCGCTCTACGAGGGCGTGGACTTC
TACACGTCCATCACCCGCGCCCGCTTCGAGGAGCTCAACGCCGACCTGTTCCGCGGGACC
CTGGAGCCGGTGGAGAAGGCGCTGCGCGACGCCAAGCTGGACAAGGGCCAGATCCAGGAG
ATCGTGCTGGTGGGCGGCTCTACCCGCATCCCCAAGATTCAGAAGCTGCTGCAGGATTTC
TTCAATGGCAAGGAGCTGAACAAGAGCATCAACCCCGACGAGGCGGTGGCCTACGGAGCC
GCGGTACAGGCAGCCATCCTCATCGGGGACAAGTCAGAGAACGTGCAGGACCTGCTGCTA
CTCGACGTGACCCCGTTGTCCCTGGGCATCGAGACGGCTGGCGGCGTCATGACCCCACTC
ATCAAGAGGAACACCACGATCCCCACCAAGCAGACGCAGACCTTCACCACTTACTCAGAC
AACCAGAGCAGCGTGCTGGTGCAGGTGTACGAGGGCGAACGGGCCATGACCAAGGACAAT
AACCTGCTGGGCAAGTTCGACCTGACCGGGATTCCCCCGGCGCCCCGCGGCGTCCCCCAG
ATCGAGGTCACCTTCGACATCGACGCCAACGGCATCCTCAACGTCACCGCCGCCGACAAG
AGCACCGGTAAAGAAAACAAAATCACCATCACCAACGATAAGGGTCGTCTGAGCAAGGAC
GACATTGACCGGATGGTGCAGGAGGCGGAGCGGTACAAGTCGGAAGATGAGGCCAATCGC
GACCGGGTCGCGGCCAAAAACGCCGTGGAGTCCTATACCTACAACATCAAGCAGACGGTG
GAAGACGAGAAACTGAGGGGCAAGATTAGCGACCAGGACAAAAACAAGATCCTCGACAAG
TGTCAGGAGGTGATCAACTGGCTCGACCGAAACCAGATGGCAGAGAAAGATGAGTATGAA
CACAAGCAGAAAGAGCTTGAAAGAGTGTGCAACCCCATCATCAGCAAACTTTACCAAGGC
GGCCCTGGCGGCGGCGGCGGTTCTGGAGCCTCCGGGGGA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 113.88
SRP021940_cerebellum 157.82
SRP021940_embryo 19.64
SRP021940_placental_villous 107.05
SRP021940_synovial_membrane 11.2
SRP021940_testis 1268.43

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
PEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKK--VGAERNVLIFDLGGGTFDVSILTIE
PEE.SSMVLTKMKEIAEAYLG..V..AV.TVPAYFNDSQRQATKDAGTI.GLNVLRIINEPTAAAIAYGLDKK...G.E.NVLIFDLGGGTFDVSILTIE
Retrocopy
PEEISSMVLTKMKEIAEAYLGGKVQSAVITVPAYFNDSQRQATKDAGTITGLNVLRIINEPTAAAIAYGLDKKGCTGGEKNVLIFDLGGGTFDVSILTIE


Parental protein
DGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGT
DGIFEVKSTAGDTHLGGEDFDNRMV.H...EFKRKHKKDI..NKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEG.DFYTSITRARFEELNADLFRGT
Retrocopy
DGIFEVKSTAGDTHLGGEDFDNRMVSHLAEEFKRKHKKDIAPNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGT


Parental protein
LDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVL
L.PVEKALRDAKLDK.QI..IVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAIL.GDKSENVQDLLLLDVTPLSLGIETAGGVMT.L
Retrocopy
LEPVEKALRDAKLDKGQIQEIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILIGDKSENVQDLLLLDVTPLSLGIETAGGVMTPL


Parental protein
IKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKE
IKRNTTIPTKQTQTFTTYSDNQ..VL.QVYEGERAMTKDNNLLGKF.LTGIPPAPRGVPQIEVTFDIDANGILNV.A.DKSTGKENKITITNDKGRLSK.
Retrocopy
IKRNTTIPTKQTQTFTTYSDNQSSVLVQVYEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVTFDIDANGILNVTAADKSTGKENKITITNDKGRLSKD


Parental protein
DIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQS
DI.RMVQEAE.YK.EDE..RD.V..KN..ESY..N.K.TVEDEKL.GKI.D.DK.KILDKC.E.INWLD.NQ.AEK.E.EH.QKELE.VCNPII.KLYQ.
Retrocopy
DIDRMVQEAERYKSEDEANRDRVAAKNAVESYTYNIKQTVEDEKLRGKISDQDKNKILDKCQEVINWLDRNQMAEKDEYEHKQKELERVCNPIISKLYQ-


Parental protein
AGGMPGGMPGGFPGG
.GG..GG...G..GG
Retrocopy
-GGPGGGGGSGASGG


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide