RetrogeneDB ID:
retro_ecab_630
Organism:
Horse ( Equus_caballus )
Location:
24:32832214-32832567 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
60.16 %
Coverage:
61.98 %
Frameshifts:
4
Stop codons:
1


Parental gene:
Parental gene symbol:
RPL9
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein L9 [Source:HGNC Symbol;Acc:10369]

Genomic region (view in browser)





>retro_ecab_630
ATAAAGATCATTCTCAGCAATGGATTGTCGACTTTTCAGAAAATGTTGACATCATTCTGA
AGGGGGACACAGTTATTGAGATGGGTCCCAGAGGAAACTTGCACAGGGACTTGAATCTCA
TCAGTAGAGAACTCAGTCTCCTTGGAAAGAAAACAAAGAGGCTCCAGGTTGACAAATGGT
AGGGAAATAGAAAGGACTGACTACCAGTTGCATTATCTGTAGTCATATACAGAACATGAT
GGAGAGTGTTACACTGGGCTTCCATTACAAGACGAAGTCTGTGTATGCTCACTTCCTAAT
CAGTTGTTACTCAGGAGAACGAGTCTCTTGTTAAAATCTGAAAATTCTTGGGC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.05
SRP021940_embryo 0.19
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.1
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MKTILSNQT-VDIPENVDITLKGRTVIVKGPRGTLRRDFNHINVELSLLGKKKKRLRVDKWWGNRKE-LATVRTICSHVQNMIKGVTLGFRYKMRSVYAH
.K.ILSN...VD..ENVDI.LKG.TVI..GPRG.L.RD.N.I..ELSLLGKK.KRL.VDKW.GNRK..L.T...ICSH.QNM...VTLGF.YK..SVYAH
Retrocopy
IKIILSNGL/VDFSENVDIILKGDTVIEMGPRGNLHRDLNLISRELSLLGKKTKRLQVDKW*GNRKD/LTTSCIICSHIQNMMESVTLGFHYKTKSVYAH


Parental protein
F-PINVVIQENGSLVEIRN-FLG
F.P..........L....N.FLG
Retrocopy
F/PNQLLLRRTSLLLKSEN/FLG


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide