RetrogeneDB ID:
retro_ecab_631
Organism:
Horse ( Equus_caballus )
Location:
24:45036376-45036681 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
61.68 %
Coverage:
92.17 %
Frameshifts:
1
Stop codons:
1


Parental gene:
Parental gene symbol:
TSTD1
Parental gene aliases:
No gene alias available
Parental gene description:
thiosulfate sulfurtransferase (rhodanese)-like domain containing 1 [Source:HGNC Symbol;Acc:35410]

Genomic region (view in browser)





>retro_ecab_631
CCTGGGCTCTGTCTGCTCCCAGCTTCCAACTGGGCTAGCTCAGTATATGTGAGGTCTGGG
ACGCGGAGGCAGCTGGGACCTTGCCCTGGGTGCTCAACATCCCGGTGTCTAAGTTAGAAA
GCACCCTGCAGATGGAGGCAGCTGCTTCCCAGGCTTCGTACTCCACTGAGAAGCCAAAGC
TGGAAGATGAGAATCTCGTTTTGTCAGACAGGGGCTTGCAGGCCACTCAGTGGGCCCAGG
GACCTGGATTCACAGGTGCTCGCAGCCACGCAGGGGCCTACAGAGAATGGTTCCAGTAGG
AAGGT

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
PELRSLLALGRARLIDVRSR-EEAAAGTIPGALNIPVSELESALQMEPAAFQALYSTQKPKLEDENLIFFCQMGKRGLQATQLAQGLGYTGARNYTGAYR
P.L..L.A...A....VRS.....AAGT.P..LNIPVS.LES.LQME.AA.QA.YST.KPKLEDENL........RGLQATQ.AQG.G.TGAR...GAYR
Retrocopy
PGLCLLPASNWASSVYVRSG/DAEAAGTLPWVLNIPVSKLESTLQMEAAASQASYSTEKPKLEDENLV----LSDRGLQATQWAQGPGFTGARSHAGAYR


Parental protein
EWLQQEG
EW.Q.EG
Retrocopy
EWFQ*EG


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide