RetrogeneDB ID:
retro_ecab_632
Organism:
Horse ( Equus_caballus )
Location:
24:7488841-7489722 (-)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
93.22 %
Coverage:
100.0 %
Frameshifts:
2
Stop codons:
0


Parental gene:
Parental gene symbol:
RPS2
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein S2 [Source:HGNC Symbol;Acc:10404]

Genomic region (view in browser)





>retro_ecab_632
ATGGCGGATGACGCCGGTCCTGCGGCAGGGTCTGGAGGGCCCAGGGGGCCCCGGCCTGGG
AAGCCGTGGAGGCTTCCGCGGACGCTTCGGCAGTGGCGTCTGGGGCTGGGGGTCGCGGCC
GTGGTCGGAGCCGGGGCCGAGGCCGCGGAGCTCGCGGAGGCAAGGCCGAGGACAAGGAGT
GGATCCCCGTCACCAAGCTGGGTCGCCTGGTCCAAGACATGAAGAGCAAGTCCCTGGAGG
AAATCTACCTTTTCTCCCTGCCCATCAAAGAGTCTGAGATCATTGACTTTTTCCTGGGGG
CATCTCTTAAGGATGAGGTTTTGAAGATTATGCCGGTGCAAAAGCAGACCCGTGCTGGCC
AGCGGACCAGGTTCAAGGCATTTGTTGCCATTGGGGATTACAATGGACATGTCGATCTGG
GTGTTAAGTGCTCCAAGGAGGTAGCCACTGCCATCTGTGAGGCCATCGTCCTTGCCAAGC
TCTCCATTGTCCCGGTGCGACGAGGCTACTGGTGGAACAAGATCAGCAAGCCCCATACTG
TTCCTTGCAAGGTGACAGGTCGCTGTGGCTCTGTGCTGGTGCGCCTCATCCCTGCCCCCA
GGGGCGCTGGCATTGTGTCAGCCCCTGTGCCCAAGAAGCTCTTGATGATGGCTGGTATTG
ACGACTGCTACATCTCGGCCAGGGGCTGCACTGCCACCCTTGGCAACTTTGCCAAGGCCA
CCTTTGATGCCATCTCTAAGACCTACAGCTATCTCACCCCAGACCTCTGGAAAGAGACCG
TGTTCACCAAGTCTCCCTATCAGGAGTTCACTGACCATCTTGTAAAGAACCACACCAGAG
TCTCCATGCAGAGGACCCAGGCTCCAGCTGTGGCTACCACA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.75
SRP021940_cerebellum 0.2
SRP021940_embryo 1.32
SRP021940_placental_villous 0.58
SRP021940_synovial_membrane 1.59
SRP021940_testis 0.3

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MADDAGAAGGPGGP-GGPGLGSRGGFRGGFGSGVRG-RGRGRGRGRGRGRGARGGKAEDKEWIPVTKLGRLVKDMKIKSLEEIYLFSLPIKESEIIDFFL
MADDAG.A.G.GGP.GGPGLGSRGGFRG.FGSGV.G..GRGRGR.RGRGRGARGGKAEDKEWIPVTKLGRLV.DMK.KSLEEIYLFSLPIKESEIIDFFL
Retrocopy
MADDAGPAAGSGGP\GGPGLGSRGGFRGRFGSGVWG\GGRGRGRSRGRGRGARGGKAEDKEWIPVTKLGRLVQDMKSKSLEEIYLFSLPIKESEIIDFFL


Parental protein
GASLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDYNGHVGLGVKCSKEVATAIRGAIILAKLSIVPVRRGYWGNKIGKPHTVPCKVTGRCGSVLVRLIPA
GASLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDYNGHV.LGVKCSKEVATAI..AI.LAKLSIVPVRRGYW.NKI.KPHTVPCKVTGRCGSVLVRLIPA
Retrocopy
GASLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDYNGHVDLGVKCSKEVATAICEAIVLAKLSIVPVRRGYWWNKISKPHTVPCKVTGRCGSVLVRLIPA


Parental protein
PRGTGIVSAPVPKKLLMMAGIDDCYTSARGCTATLGNFAKATFDAISKTYSYLTPDLWKETVFTKSPYQEFTDHLVKNHTRVSVQRTQAPAVATT
PRG.GIVSAPVPKKLLMMAGIDDCY.SARGCTATLGNFAKATFDAISKTYSYLTPDLWKETVFTKSPYQEFTDHLVKNHTRVS.QRTQAPAVATT
Retrocopy
PRGAGIVSAPVPKKLLMMAGIDDCYISARGCTATLGNFAKATFDAISKTYSYLTPDLWKETVFTKSPYQEFTDHLVKNHTRVSMQRTQAPAVATT


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide