RetrogeneDB ID:
retro_ecab_641
Organism:
Horse ( Equus_caballus )
Location:
24:44055368-44055684 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
66.98 %
Coverage:
82.03 %
Frameshifts:
1
Stop codons:
1


Parental gene:
Parental gene symbol:
UBA52
Parental gene aliases:
No gene alias available
Parental gene description:
ubiquitin A-52 residue ribosomal protein fusion product 1 [Source:RefSeq peptide;Acc:NP_001229382]

Genomic region (view in browser)





>retro_ecab_641
ATGCAGATCTTTGTGAAGACCCTGACGGGCAAGACCATCACCTTCGAGGTCGAGGCCAGT
GACACCACTGAGAATGTTAAAGCTAAAATCCAAGACAACGAGGGCATCTTGCCTGACCAG
CAGCGTCTGGTTTGTGCGGGCAGATAGCTGGAGGATGACGGCGCTCCCTCAGACTACAAT
ACCCAGGAAGGCTCCACCCTGTGCTCGGAGCTTCACCCACGGAGCGACATCACTGAGCCT
TCCCTCCCGCCAGCTTGCCCAGGAACACAAGTGCCACAGGATGATGTGCCGCCAGAGCTG
TGCTCATCTGCACCCG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.05
SRP021940_embryo 0.14
SRP021940_placental_villous 0.04
SRP021940_synovial_membrane 0.16
SRP021940_testis 0.06

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGIIEPSL-RQLAQKYNCDKMICRKC
MQIFVKTLTGKTIT.EVE.SDT.ENVKAKIQD.EGI.PDQQRL..AG..LED....SDYN.Q..STL...L..R..I.EPSL.RQLAQ...C..M.CR..
Retrocopy
MQIFVKTLTGKTITFEVEASDTTENVKAKIQDNEGILPDQQRLVCAGR*LEDDGAPSDYNTQEGSTLCSELHPRSDITEPSL\RQLAQEHKCHRMMCRQS


Parental protein
YARLHP
.A.LHP
Retrocopy
CAHLHP


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide