RetrogeneDB ID:
retro_ecab_642
Organism:
Horse ( Equus_caballus )
Location:
25:6834234-6835037 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
57.61 %
Coverage:
98.9 %
Frameshifts:
4
Stop codons:
4


Parental gene:
Parental gene symbol:
No gene symbol available
Parental gene aliases:
No gene alias available
Parental gene description:
No gene description available

Genomic region (view in browser)





>retro_ecab_642
GAGATAAACAATCTACCTGATAAACAGTAAAAACTACTAGTCATAAGGATGCTCAATGAT
CTTAGGAGAAGAACAGATGAACACAATGAGAATTTTAACAAAGACTTGGAAAATATAAAA
AAGAACCAATCAGAACTGAAGTATAATGGAAATGAAAAATTCACTAGAGGGAATCAACAG
TACAGTATATGACACAGAACAGATCAGCAATCTGGATGAAAGAGTAGAGGAAATCACTCA
AGCTAAACAGAAAAAAGAAAAAAGGATTAAAAGGAAAGAGGACAGTCTAAGGGACCTCTG
GGACAACAGTAAGTGTACTAAATCTGTATTATAGGTGTCCCAGAAGGAGATGAGAGACAA
AGGGGCAGAGAACTTATTTGAAGAAATAATAGCCAAAAACTTCCCTAACTGGGGAAGGAA
ATGGACATCCAGGTACAGGAAACACGGAGCACCAAACAAGATGAACCCAAAGAGGCCCAC
ATCAAGATACATTATAATTAAAATGTCAAGAATTAAAGATAAACAGAGAATGCTAAAAGC
TGCAAAAGAAAAGCAAAAAGTTACATACAAAGGAAACCCCCCAGGCTATCAGCTGACTTC
TCAGCAGAAACCTTACAGGATAGCAGGGAGTGACATGATATATTCCAAGTGCTGAGAGGA
AAAAGACCTACAGCCAAGAATACTCTAATTGGCAAGGCAATCATTCAGAATGGAAGGAGA
GAGAGAGTTTTCCAGATGAGCAAAAACTAAAGGAATTCGTCACTACTAAACCAGCCTTAC
AAGAAAGGTTAAAGGGACTTATT

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.06
SRP021940_cerebellum 0.0
SRP021940_embryo 0.26
SRP021940_placental_villous 0.13
SRP021940_synovial_membrane 0.03
SRP021940_testis 1.84

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
EINNLPDKEFKQKVIRMLTDLGRRMDEPSGNFNKELENIKKNQSKNKHRLKQKTTHQLGKNICKDSI-AQERTNKLDKRLEEITQADQIKEKRIKKNEDG
EINNLPDK..K..VIRML.DL.RR.DE...NFNK.LENIK....KN...LK..............SI...E....LD.R.EEITQ............ED.
Retrocopy
EINNLPDKQ*KLLVIRMLNDLRRRTDEHNENFNKDLENIK----KNQSELKYNGNEKFTRGNQQYSI\DTEQISNLDERVEEITQXXXXXXXXXXXXEDS


Parental protein
LRDLWNNIKHTNIHIIDVPEGEERDKGAENLFGEIIAENFPNLRRKYPGEAQR--APNKINPKRPTPRHIIIKMSKSKDKERILNALRERQQVTYKGNPI
LRDLW.N.K.T......V...E.RDKGAENLF.EIIA.NFPN..RK.........APNK.NPKRPT.R.IIIKMS..KDK.R.L.A..E.Q.VTYKGNP.
Retrocopy
LRDLWDNSKCTK-SVL*VSQKEMRDKGAENLFEEIIAKNFPNWGRKWTSRYRKHGAPNKMNPKRPTSRYIIIKMSRIKDKQRMLKAAKEKQKVTYKGNPP


Parental protein
-RLSANFSAETLETRREWHDILKVLKGK-NLQPRILYSARLSF-MEGEIEF-PDKQNLEEFITKKPALQEMLNGLI
.RLSA.FSAETL...RE.HDI..VL.GK..LQPRIL..AR.SF.MEGE.EF.PD.Q.L.EF.T.KPALQE.L.GLI
Retrocopy
/RLSADFSAETLQDSRE*HDIFQVLRGK\DLQPRIL*LARQSFRMEGEREF\PDEQKLKEFVTTKPALQERLKGLI


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide