RetrogeneDB ID:
retro_ecab_649
Organism:
Horse ( Equus_caballus )
Location:
25:31698225-31698677 (+)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
56.86 %
Coverage:
91.02 %
Frameshifts:
1
Stop codons:
1


Parental gene:
Parental gene symbol:
PPIF
Parental gene aliases:
No gene alias available
Parental gene description:
peptidylprolyl isomerase F [Source:HGNC Symbol;Acc:9259]

Genomic region (view in browser)





>retro_ecab_649
GACTGCGAGCCCTTGGGCCGAGTCTCCTTCAAGCTGTTTGCAGACTAAGTTCTAAAGGCA
GCAGACAAGGTTCGTGCTCTGAGCACTGGGGAGAAAGGACTTGGTTATGAAGTTTTCTGC
TTTCACAGAATTATTCCAGGATTTATGTGCCAGGTTGGTGACTTCACACAGCATACTGGC
ACCGGTGGAGAGTCCCCCTACAGGGAGAAATTTGATGATGAATATTTCATCTGGAAGCAC
GTGGGTCCTGGCATCTTGTCCACGGCATGTGCTGGCCCCAGCACAAACAGTTCCCGGGTT
TTCACCTGCACTGCCAAGACTGAGTGGCTGGATGGCAGGCATGTGGTCTTTGGCAAGGAG
GAAAGGACATGACTCTCACAGAAGCCAAGGGGCACTTTGGGTCCAGGAATGGTAAGACCA
GCAAGAACACCGTTGCTGTCTGTGGACGACTC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.06
SRP021940_cerebellum 0.7
SRP021940_embryo 0.17
SRP021940_placental_villous 0.09
SRP021940_synovial_membrane 0.1
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
DGQTLGRVVLELNADVVPKTAENFRALCTGEKGFGYKGSTFHRVIPAFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQF
D...LGRV...L.AD.V.K.A...RAL.TGEKG.GY....FHR.IP.FMCQ.GDFT.H.GTGG.S.Y...F.DE.F..KHVGPG.LS.A.AGP.TN.S..
Retrocopy
DCEPLGRVSFKLFAD*VLKAADKVRALSTGEKGLGYEVFCFHRIIPGFMCQVGDFTQHTGTGGESPYREKFDDEYFIWKHVGPGILSTACAGPSTNSSRV


Parental protein
FICTIKTDWLDGKHVVFGHVK-EGMDVVKKIESFGSKSGKTSKKIVITDCGQL
F.CT.KT.WLDG.HVVFG......M........FGS..GKTSK..V...CG.L
Retrocopy
FTCTAKTEWLDGRHVVFGKEE/KDMTLTEAKGHFGSRNGKTSKNTVAV-CGRL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide