RetrogeneDB ID:
retro_ecab_653
Organism:
Horse ( Equus_caballus )
Location:
25:16949180-16949772 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
61.06 %
Coverage:
98.52 %
Frameshifts:
7
Stop codons:
5


Parental gene:
Parental gene symbol:
RPL13A
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein L13a [Source:HGNC Symbol;Acc:10304]

Genomic region (view in browser)





>retro_ecab_653
GGGCAGGTCCTGGTGCTGGATGACCCAGGCCATCTGCCCGGGTACCTGGCGGCCGTCATA
GCCAAACAGTTCCCGCTGGGCTGGGAGGTGGTGGTCGTGCGCTGTGAGGGCATCAACATT
TCTGTCAATTTCCACAGAAACAGATGAAAGTACCTGGCCTTCGTCTGAAAGCGGATGATT
GCCAACCTGTCCTGTGGCAGTTATCACTTCCAAACCCCCAGCCGCATCTCTTGGGCGATG
CCCAGCAGGCTGCCCCGAAGACCAAGAGCAGCCAGGCCACCCTGAGCGCTTCAAGGCATT
TGATGGGGCTGCGGCTCTATGACAAGAAAAAGCAGAGGGTGGTTCCTGCTGCCCTCAAGG
CTATGCGTCTGAATCCACACGAATTTTGCCTAAATCGGGCGTCTGGCTCACGAGGTTGGC
TGGAAGAACCAGGCGGTGACAGCCACCCTGGAGGAGAAGGGAAGGAGAAGGCCAGATCCG
CTACCAGCAGGAAGAACAGCTCAGGAGCCCGCGCAAACAGGCCAAAAAGAACGCGCAGAA
GAAAACTGACTAATACTCCCCAGAGGTCCTCAAGACCCTCGGACTCCTGGTC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.05
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.05
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
GQVLVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNPSRGPYHFRAPSRIFWRTVRGMLPH-KTKRGQAAL-DR
GQVLVLD..GHL.G.LAA..AKQ..LG..VVVVRCEGINIS.NF.RN..KYLAF..KRM..N.S.G.YHF..PSRI.W......LP..KTK..QA.L..R
Retrocopy
GQVLVLDDPGHLPGYLAAVIAKQFPLGWEVVVVRCEGINISVNFHRNR*KYLAFV*KRMIANLSCGSYHFQTPSRISW-AMPSRLPR/KTKSSQATL/ER


Parental protein
LKVFDGIPPPYDKK-KRMVVPAALKVVRLKP-TR-KFAYLGRLAHEVGWKYQAVTATLEEK-RKEKAK-IHYRKKKQLTRLRKQAEKNVEKKIDRYT-EV
.K.FDG.......K..R.V..A.LK..RL.P.TR..FA..GRLAHEVGWK.QAVTATLEEK..KEKA..I.Y....QL...RKQA.KN..KK.D.Y..EV
Retrocopy
FKAFDGAAAL*QEK\QRVVPAA-LKAMRLNP/TR/NFA*IGRLAHEVGWKNQAVTATLEEK/GKEKAR/IRYQQEEQLRSPRKQAKKNAQKKTD*YSPEV


Parental protein
LKTHGLLV
LKT.GLLV
Retrocopy
LKTLGLLV


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide