RetrogeneDB ID:
retro_ecab_655
Organism:
Horse ( Equus_caballus )
Location:
26:13346797-13347460 (+)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
95.48 %
Coverage:
67.17 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
CNN3
Parental gene aliases:
No gene alias available
Parental gene description:
calponin 3, acidic [Source:HGNC Symbol;Acc:2157]

Genomic region (view in browser)





>retro_ecab_655
ATCTTTTTGAGAATGGAAACGACCCAGGTTCAGACTACGCTGGTGGCTCTAGCAGGTCTG
GCTAAAACAAAAGGATTCCATACAACCATTGACGTTGGAGTTAAGTATGCAGAAAAACAA
ACAAGACGTTTTGATGAAGGAAAATTAAAGGCTGGCCAGAGTGTAATTGGTTTGCAGATG
GGAACCAACAAATGCGCCAGCCAAGCAGGTATGACAGCCTATGGGACTAGGAGGCATCTT
TATGATCCCAAAATGCAAACTGACAAACCTTTTGACCAGACCACGATTAGTCTGCAGATG
GGCACCAACAAAGGAGCCAGCCAGGCGGGGATGTTAGCGCCGGGTACCAGGAGAGACATC
TACGATCAGAAGCTAACATTACAACCAGTGGACAACTCGACAATTTCTCTACAGATGGGT
ACCAACAAAGTCGCTTCCCAGAAAGGAATGAGTGTGTATGGGCTGGGGCCGCAAGTATAT
GATCCCAAATACTGTGCTGCTCCAACAGAACCTGTCATTCACAATGGAAGCCAAGGAACA
GGAACAAATGGGTCGGAAATCAGTGATAGTGATTATCAGGCAGAATACCCAGAAGAATAT
CATGGCGAGTACCAAGATGCCTACCCCAGAGATTACCAATATGGCGACCAAGGCCTTGAT
TAT

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.15
SRP021940_embryo 0.26
SRP021940_placental_villous 0.09
SRP021940_synovial_membrane 0.34
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
LFENGNMTQVQTTLVALAGLAKTKGFHTTIDVGVKYAEKQTRRFDEGKLKAGQSVIGLQMGTNKCASQAGMTAYGTRRHLYDPKMQTDKPFDQTTISLQM
.F.....TQVQTTLVALAGLAKTKGFHTTIDVGVKYAEKQTRRFDEGKLKAGQSVIGLQMGTNKCASQAGMTAYGTRRHLYDPKMQTDKPFDQTTISLQM
Retrocopy
IFLRMETTQVQTTLVALAGLAKTKGFHTTIDVGVKYAEKQTRRFDEGKLKAGQSVIGLQMGTNKCASQAGMTAYGTRRHLYDPKMQTDKPFDQTTISLQM


Parental protein
GTNKGASQAGMLAPGTRRDIYDQKLTLQPVDNSTISLQMGTNKVASQKGMSVYGLGRQVYDPKYCAAPTEPVIHNGSQGTGTNGSEISDSDYQAEYPDEY
GTNKGASQAGMLAPGTRRDIYDQKLTLQPVDNSTISLQMGTNKVASQKGMSVYGLG.QVYDPKYCAAPTEPVIHNGSQGTGTNGSEISDSDYQAEYP.EY
Retrocopy
GTNKGASQAGMLAPGTRRDIYDQKLTLQPVDNSTISLQMGTNKVASQKGMSVYGLGPQVYDPKYCAAPTEPVIHNGSQGTGTNGSEISDSDYQAEYPEEY


Parental protein
HGEYQDDYPRDYQYGDQGIDY
HGEYQD.YPRDYQYGDQG.DY
Retrocopy
HGEYQDAYPRDYQYGDQGLDY


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide