RetrogeneDB ID:
retro_ecab_66
Organism:
Horse ( Equus_caballus )
Location:
19:45277339-45278728 (-)
Status:
KNOWN_PROTEIN_CODING
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
99.57 %
Coverage:
100.0 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
eca-mir-703
Parental gene aliases:
EEF1A1, EF-1A, EF-Tu, EF1A, eEF1A-1
Parental gene description:
eca-mir-703 [Source:miRBase;Acc:MI0012753]

Genomic region (view in browser)





>retro_ecab_66
ATGGGGAAGGAAAAGACTCATATCAACATCGTCGTCATTGGACACGTCGATTCGGGCAAG
TCCACCACGACTGGCCACCTGATCTACAAGTGCGGTGGGATCGACAAAAGAACCATCGAG
AAATTCGAGAAGGAGGCTGCTGAGATGGGAAAGGGCTCCTTCAAGTATGCCTGGGTCTTG
GATAAACTGAAAGCTGAACGTGAGCGTGGTATCACCATTGATATCTCCCTGTGGAAATTC
GAGACCAGCAAGTATTATGTGACCATCATTGATGCCCCCGGACACAGAGACTTCATCAAA
AACATGATTACAGGCACGTCTCAGGCTGACTGTGCTGTCCTCATTGTCGCTGCTGGTGTT
GGTGAATTTGAAGCAGGTATCTCCAAGAATGGGCAGACCCGTGAGCATGCCCTTCTGGCT
TACACACTGGGTGTGAAACAACTAATTGTTGGTGTTAACAAAATGGATTCCACTGAGCCA
CCTTACAGCCAGAAGAGATATGAGGAAATCGTTAAGGAAGTCAGCACCAACATTAAGAAA
ATTGGTTACAACCCAGACACAGTTGCATTTGTGCCAATTTCTGGTTGGAATGGTGACAAC
ATGCTGGAGCCAAGTGCTAATATGCCTTGGTTCAAGGGATGGAAAGTCACCCGTAAAGAT
GGCAATGCCAGTGGAACTACACTGCTTGAAGCTCTGGATTGCATCCTGCCACCAACTCGT
CCAACTGATAAGCCCTTGCGTCTGCCCCTCCAGGACGTCTACAAAATTGGTGGTATCGGT
ACTGTCCCTGTGGGCCGAGTGGAGACTGGTGTTTTGAAACCTGGCATGGTGGTCACCTTT
GCTCCAGTCAATGTTACAACTGAAGTAAAGTCTGTTGAAATGCATCATGAAGCTTTGAGC
GAAGCTCTTCCTGGGGACAACGTGGGCTTCAATGTCAAGAACGTGTCCGTCAAAGATGTT
CGCCGTGGCAATGTGGCTGGTGACAGCAAAAATGATCCACCAATGGAAGCAGCTGGCTTC
ATAGCTCAGGTGATTATCCTGAACCATCCAGGCCAAATCAGTGCTGGGTATGCACCTGTG
CTGGATTGTCACACAGCTCACATTGCTTGCAAGTTTGCTGAGCTGAAGGAGAAGATTGAT
CGTCGTTCTGGAAAGAAGCTGGAAGATGGCCCCAAATTCTTGAAATCTGGTGATGCTGCC
ATCGTTGATATGGTTCCTGGCAAGCCCATGTGTGTTGAGAGCTTTTCTGACTATCCTCCT
CTGGGCCGTTTTGCTGTTCGTGACATGAGACAGACGGTTGCTGTGGGTGTCATCAAAGCA
GTGGACAAGAAAGCAGCTGGAGCTGGCAAGGTCACCAAGTCTGCCCAGAAGGCTCAGAAG
GCTAAATGA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 1.51
SRP021940_cerebellum 0.35
SRP021940_embryo 2.97
SRP021940_placental_villous 0.98
SRP021940_synovial_membrane 14.69
SRP021940_testis 0.42

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIK
MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIK
Retrocopy
MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIK


Parental protein
NMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDN
NMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVST.IKKIGYNPDTVAFVPISGWNGDN
Retrocopy
NMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTNIKKIGYNPDTVAFVPISGWNGDN


Parental protein
MLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPVNVTTEVKSVEMHHEALS
MLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPVNVTTEVKSVEMHHEALS
Retrocopy
MLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPVNVTTEVKSVEMHHEALS


Parental protein
EALPGDNVGFNVKNVSVKDVRRGNVAGDSKNDPPMEAAGFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDGPKFLKSGDAA
EALPGDNVGFNVKNVSVKDVRRGNVAGDSKNDPPMEAAGF.AQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDGPKFLKSGDAA
Retrocopy
EALPGDNVGFNVKNVSVKDVRRGNVAGDSKNDPPMEAAGFIAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDGPKFLKSGDAA


Parental protein
IVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVDKKAAGAGKVTKSAQKAQKAK
IVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVDKKAAGAGKVTKSAQKAQKAK
Retrocopy
IVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVDKKAAGAGKVTKSAQKAQKAK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide