RetrogeneDB ID:
retro_ecab_664
Organism:
Horse ( Equus_caballus )
Location:
26:13974203-13974856 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
57.66 %
Coverage:
87.4 %
Frameshifts:
1
Stop codons:
1


Parental gene:
Parental gene symbol:
RBMX2
Parental gene aliases:
No gene alias available
Parental gene description:
RNA binding motif protein, X-linked 2 [Source:HGNC Symbol;Acc:24282]

Genomic region (view in browser)





>retro_ecab_664
TTAGCCACGGTGAAGCTGGTTAGCCAGCTGAGTGAGTGGGAGGCCGACACGGCCATGGCT
GCGAAGGCGAACTGGCGCTCAGTGTAGAAGGACAGCGCCTGGGTCTTCCTGGGAGCGTTT
CCTTATGAGCTGACGGAAGGAGACGTCCTCTGCGTGTTCTCCCTGTACGGGGAGATTGTT
AACGTTAATCTCGTGCGGGCCGGGAAGACAGGGAAGTCTAAAGGATTCTGCTTTCTCTGT
TATGAAGACCAGAGGAGTACAGTTTTGGCCGTTGACAGTCTTAATGGCGTCAAGATCAAG
GGAAGAGCTATCCGAGTGGACCACGTATCCCGCTCCCGCCCCCCTCGGGCCTCACAGGAT
GTGGATGACGCCACCAGAGAGCTCTGGGCGAAGGGCTGCGGGGCTGAGACCCCTCATCCA
GTTCATCTGAGGGCTCTGAAGACGAAGCCCTCTCAGCACAGCACAAACAAGAAAAACAGA
CAAGAAAAAAGACCGAAGAGAAGACTGTTGTATTAGTTAAAGAGGAAGAGGGACAGTCAG
AGCAGCCCTCGTCCCTGCCAGCCGGAGGCCAGACTGAAATGGAGAGGGACGCCCCAGGCT
CCGATAAACAAACCCAGGTAAAGTTAGGGTCTAGAGAGGGCCAGAAACCTGAC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 8.31

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
LTKVKLINELNEREVQLGVADKVSWHSEYKDSAWIFLGGLPYELTEGDIICVFSQYGEIVNINLVRDKKTGKSKGFCFLCYEDQRSTILAVDNFNGIKIK
L..VKL...L.E.E.....A.K..W.S..KDSAW.FLG..PYELTEGD..CVFS.YGEIVN.NLVR..KTGKSKGFCFLCYEDQRST.LAVD..NG.KIK
Retrocopy
LATVKLVSQLSEWEADTAMAAKANWRSV*KDSAWVFLGAFPYELTEGDVLCVFSLYGEIVNVNLVRAGKTGKSKGFCFLCYEDQRSTVLAVDSLNGVKIK


Parental protein
GRTIRVDHVSNYRAPKDSEEMDDVSKGLQEKGCGARTPSP-SSSEGSEDDKPTKKHKKDKKEKKKRKKDKEKTDREVQEEQPAS---SSSPR-SKTIKEK
GR.IRVDHVS..R.P..S...DD....L..KGCGA.TP.P.SSSEGSED......HK....EK..RKK..EKT...V.EE...S...SS.P....T..E.
Retrocopy
GRAIRVDHVSRSRPPRASQDVDDATRELWAKGCGAETPHP/SSSEGSEDEALSAQHK---QEKQTRKKTEEKTVVLVKEEEGQSEQPSSLPAGGQTEMER


Parental protein
DDPGSKKHS--SKNSERGQKSE
D.PGS.K.......S..GQK..
Retrocopy
DAPGSDKQTQVKLGSREGQKPD


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide