RetrogeneDB ID:
retro_ecab_67
Organism:
Horse ( Equus_caballus )
Location:
15:32428650-32429721 (-)
Status:
KNOWN_PROTEIN_CODING
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
84.58 %
Coverage:
57.73 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
PCBP2
Parental gene aliases:
No gene alias available
Parental gene description:
poly(rC) binding protein 2 [Source:HGNC Symbol;Acc:8648]

Genomic region (view in browser)





>retro_ecab_67
ATGGATGCCGGTGTGACTGAAAGTGGACTAAATGTGACTCTCACCATTCGGCTGCTTATG
CACGGAAAGGAAGTAGGAAGCATCATTGGGAAGAAAGGGGAGTCGGTTAAGAGGATCCGC
GAGGAGAGTGGCGCGCGGATCAACATCTCGGAGGGGAATTGCCCGGAGAGAATCATCACT
CTGACCGGCCCCACCAATGCCATCTTTAAGGCCTTCGCTATGATCATCGACAAGCTGGAA
GAAGATATCAACAGCTCCATGACCAACAGCACGGCGGCCAGCAGGCCCCCGGTCACCCTG
AGGCTCGTGGTGCCGGCCACCCAGTGCGGCTCCCTGATTGGGAAAGGCGGGTGTAAGATC
AAAGAGATCCGCGAGAGTACGGGGGCCCAGGTCCAGGTGGCGGGGGATATGCTGCCCAAC
TCCACCGAGCGGGCCATCACCATTGCTGGCGTGCCGCAGTCTGTCACCGAGTGTGTCAAG
CAGATCTGCCTGGTCATGCTGGAGACGCTCTCCCAGTCTCCGCAAGGGAGAGTCATGACC
ATTCCGTACCAGCCCATGCCGGCCAGCTCTCCAGTCATCTGCGCGGGCGGCCAAGATCGG
TGCAGCGACGCTGCGGGCTACCCCCACGCCACCCATGACCTGGAGGGACCACCTCTAGAT
GCCTACTCGATTCAAGGACAACACACCATTTCTCCGCTCGATCTGGCCAAGCTGAACCAG
GTGGCAAGACAACAGTCTCACTTTGCCATGATGCACGGCGGGACCGGATTCGCCGGAATT
GACTCCAGCTCTCCAGAGGTGAAAGGCTATTGGGCAAGTTTGGATGCATCTACTCAAACC
ACCCATGAACTCACCATTCCAAATAACTTAATTGGCTGCATAATCGGGCGCCAAGGCGCC
AACATTAATGAGATCCGCCAGATGTCCGGGGCCCAGATCAAAATTGCCAATCCAGTGGAA
GGCTCTTCTGGTAGGCAGGTTACTATCACTGGCTCTGCTGCCAGTATTAGTCTGGCCCAA
TATCTAATCAATGCCAGGCTTTCTTCTGAGAAGGGCATGGGGTGCAGCTAG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 129.51
SRP021940_cerebellum 195.6
SRP021940_embryo 247.86
SRP021940_placental_villous 231.94
SRP021940_synovial_membrane 186.36
SRP021940_testis 171.18

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MDTGVIEGGLNVTLTIRLLMHGKEVGSIIGKKGESVKKMREESGARINISEGNCPERIITLAGPTNAIFKAFAMIIDKLEEDISSSMTNSTAASRPPVTL
MD.GV.E.GLNVTLTIRLLMHGKEVGSIIGKKGESVK..REESGARINISEGNCPERIITL.GPTNAIFKAFAMIIDKLEEDI.SSMTNSTAASRPPVTL
Retrocopy
MDAGVTESGLNVTLTIRLLMHGKEVGSIIGKKGESVKRIREESGARINISEGNCPERIITLTGPTNAIFKAFAMIIDKLEEDINSSMTNSTAASRPPVTL


Parental protein
RLVVPASQCGSLIGKGGCKIKEIRESTGAQVQVAGDMLPNSTERAITIAGIPQSIIECVKQICVVMLES---PPKG--VTIPYRPKPSSSPVIFAGGQDR
RLVVPA.QCGSLIGKGGCKIKEIRESTGAQVQVAGDMLPNSTERAITIAG.PQS..ECVKQIC.VMLE.....P.G...TIPY.P.P.SSPVI.AGGQDR
Retrocopy
RLVVPATQCGSLIGKGGCKIKEIRESTGAQVQVAGDMLPNSTERAITIAGVPQSVTECVKQICLVMLETLSQSPQGRVMTIPYQPMPASSPVICAGGQDR


Parental protein
YSTGSDSASFPHTT
.S...D.A..PH.T
Retrocopy
CS---DAAGYPHAT


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide