RetrogeneDB ID:
retro_ecab_673
Organism:
Horse ( Equus_caballus )
Location:
27:13541684-13542034 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
84.75 %
Coverage:
100.0 %
Frameshifts:
1
Stop codons:
1


Parental gene:
Parental gene symbol:
GABARAPL3
Parental gene aliases:
No gene alias available
Parental gene description:
GABA(A) receptors associated protein like 3, pseudogene [Source:HGNC Symbol;Acc:4069]

Genomic region (view in browser)





>retro_ecab_673
ATGAAGTTCCAGTAGAAGAAGGACCATCCCTTTAAATATTGGAAAAGAAAGGAGAAAAGA
TCTGGAAGAAATATCCAGACAGAGTCCCTGTGATCGTGGAGAAATCTACTAAAGTCAGAG
TGCCTGATCTGGACGAGAGGAAGTACCTAGCGCCCTCTGACCTCACTGTTGGCCAGTTCT
ACTTCTTAATCTGGAAGAGGATCCACCTGAGACCTGAGGACGCCTTATTCCTCTTTGTCA
ACAACACTATCCGTCCCACCAGCGCTGTAATGGGCCAGCTGTATGAGGACAACCATGAGG
GAGACTATTTTCTGTATGTGGCCTGCAGTGATGAGAGTGTCTATGGGAAG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.03
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MKFQYKEDHPFEYRK-KEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNH
MKFQ.K.DHPF.Y.K.K.GEKI.KKYPDRVPVIVEK..K.RVPDLD.RKYL.PSDLTVGQFYFLI.KRIHLRPEDALF.FVNNTI.PTSA.MGQLYEDNH
Retrocopy
MKFQ*KKDHPFKYWK/KKGEKIWKKYPDRVPVIVEKSTKVRVPDLDERKYLAPSDLTVGQFYFLIWKRIHLRPEDALFLFVNNTIRPTSAVMGQLYEDNH


Parental protein
EEDYFLYVAYSDESVYGK
E.DYFLYVA.SDESVYGK
Retrocopy
EGDYFLYVACSDESVYGK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide