RetrogeneDB ID:
retro_ecab_674
Organism:
Horse ( Equus_caballus )
Location:
27:22862643-22862965 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
67.27 %
Coverage:
83.72 %
Frameshifts:
2
Stop codons:
2


Parental gene:
Parental gene symbol:
COX5B
Parental gene aliases:
No gene alias available
Parental gene description:
cytochrome c oxidase subunit Vb [Source:HGNC Symbol;Acc:2269]

Genomic region (view in browser)





>retro_ecab_674
CCCAAGGGGGTTTCTGTGGTGTGCTGGATGGCATCTGGAGGTGGTGTTCCTACTGTTGAT
GAGCAGACAATGGGGTGGAGAGGGAAGTGATGATGGCTGCATGGAAGGGATTAGAGTAAT
TCAATATGCTAGCCCCAATGGCAATTTCAGGCACCAAGAAGACTCTAATTTAGTCCCCTC
CATCACCAACAAGTGAATAGTGGGCTGCGTCTGTGAAGAGGACAAGACTGCTGTCACCCA
GTTCAGGCCACACAAAGGCAAGACCCAGCATTGCCCTAATTGTGAAACCCATTACGAGCT
GATGCCCCACCAGCTGGCCTAC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
PRGVAAVRSMASGGGVPTDDEQA-TGLEREVLMAARKGLDPYNILAPKAASGTK-EDPNLVPSITNKRIVGCICEEDNSAVIWFWLHKGETQRCPSCGAH
P.GV..V..MASGGGVPT.DEQ...G.EREV.MAA.KGL...N.LAP.A.SGTK.ED.NLVPSITNK.IVGC.CEED..AV..F..HKG.TQ.CP.C..H
Retrocopy
PKGVSVVCWMASGGGVPTVDEQT/NGVEREVMMAAWKGLE*FNMLAPMAISGTK/EDSNLVPSITNK*IVGCVCEEDKTAVTQFRPHKGKTQHCPNCETH


Parental protein
YKLVPHQLAH
Y.L.PHQLA.
Retrocopy
YELMPHQLAY


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide