RetrogeneDB ID:
retro_ecab_677
Organism:
Horse ( Equus_caballus )
Location:
27:3210120-3210318 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
63.64 %
Coverage:
57.89 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
No gene symbol available
Parental gene aliases:
No gene alias available
Parental gene description:
No gene description available

Genomic region (view in browser)





>retro_ecab_677
TATTCAGTCCTCATCCCGCGTGACAACTCAGTGACCGTCAAGGAGGACAAGATCACCGCC
CTCATTCAAGTGGCTGGTGTCAATGTTGAACCTTTCTGTCCAGGCTTGTTTGCAAGGGCC
CTGGCCAACATCAAGATCAGGAGCCTCTTCTGCAGCGAGGTGGCTGGCGGCCCTGCCCCA
CAGAATGTCCTGTCCCCT

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
YSALILHDDKVTVTEDKINALIKAAGVNVEPFWPGLFAKALANVSIGSLICNVGAGGPPPPAGAAP
YS.LI..D..VTV.EDKI.ALI..AGVNVEPF.PGLFA.ALAN..I.SL.C...AGGP.P.....P
Retrocopy
YSVLIPRDNSVTVKEDKITALIQVAGVNVEPFCPGLFARALANIKIRSLFCSEVAGGPAPQNVLSP


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide