RetrogeneDB ID:
retro_ecab_683
Organism:
Horse ( Equus_caballus )
Location:
28:357121-358089 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
87.61 %
Coverage:
98.8 %
Frameshifts:
3
Stop codons:
3


Parental gene:
Parental gene symbol:
ZDHHC20
Parental gene aliases:
No gene alias available
Parental gene description:
zinc finger, DHHC-type containing 20 [Source:HGNC Symbol;Acc:20749]

Genomic region (view in browser)





>retro_ecab_683
TGCGTGGTTATGCTTTCTTGAAATGGAGAAAACGGAAAGGTCGTTGTTTACCTTGTGGGT
TTCCATCTGTTCTTGTATGTTTGTATAGTCCTATTGGATGACAATTTTTCACATCTCCCG
CTTCCCCCTCCAAAGACTTCTACTTGTCCAGTTCTGAAAAGGAACGTTATGAAAAGGAAT
TCAACCAAGAAAGACAACAAGAAATTTTGAGAAGAGCAGCAAGTGACTTACCCATCTACA
CCCTGTCAGCTGCAAGGACCGTCAGATATTGTGAAAGATGTCAGTTGATTAACATCTGAC
GTGTGCATCACTGCTCAGCATGTGATATATGTGTTCTTAAGATGGATCATCACTGTCCTT
GGGTGAATAACTGTGTGGGATTTTCTAATTATAAATTATTCCTGCTGTTTTTATTATATT
GCCTTTTCATAGCTACAACAGTTTTACAGTGCTTTATAAAATTTTGGACGAATGAACTCT
CAGCTACACGTGCAAAATTCCACGTACTTTTTCTTTTCTTTGTGTTTACAATGTTCTTCA
TCAGCGTCCTGTCGCTGTTCAGCCACCACTGCTGGCTAGTTGGGAAAAATAGAACAATAG
AATCATTCCGTGCACCCACATTTTCCTATGGACCTGATGGAAATGGTTTCTCTCTTGGAT
GCAGTAAAAATTGGAGACAAGTCTTTGGTGATGAAAAGAAATATTGGCTACTTCCAATAT
TTTCAAGTTTGGGTGATGGTTGCAGTTTCCCAACTCTCCTGGTGGGGATGGATCCAGAAC
AAGCTTCTGTTTCAAACCAAAACAAATATGCCAGAAGTATTGGCTCAAATCAACCCTTTC
CTGTCAAACCACTTAGTGAATCGAAAAACCGGTTATTGGACAGTGAGTCTCAGTGGCTAG
AGAACGGATCTGAAAAAAGCACCGTCAGATCAGGGACAAATAACCATGTTACAGTGGCAA
TAGAAAAT

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.06
SRP021940_cerebellum 0.05
SRP021940_embryo 0.02
SRP021940_placental_villous 0.13
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.3

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
CIFTVLFNRCSGKAVVYLV-GFHLFFV-MFVWSYWMTVF-TSPASPSKEFYLSSSDKERYEKEFNQERQQEILRRTARDLPISTLSAARTIRYCERCQLI
C......N...GK.VVYLV.GF....V.MFV.SYWMT.F.TSPASPSK.FYLSSS.KERYEKEFNQERQQEILRR.A.DLPI.TLSAART.RYCERCQLI
Retrocopy
CVVMLS*NGENGKVVVYLV/GFPSVLV/MFV*SYWMTIF\TSPASPSKDFYLSSSEKERYEKEFNQERQQEILRRAASDLPIYTLSAARTVRYCERCQLI


Parental protein
KPDRAHHCSACDICVLKMDHHCPWVNNCVGFSNYKFFLLFLLYSLLYCLFVATTVLQCFIKFWTNELSATRAKFHVLFLFFVSTMFFISVLSLFSYHCWL
...R.HHCSACDICVLKMDHHCPWVNNCVGFSNYK.FLLF....LLYCLF.ATTVLQCFIKFWTNELSATRAKFHVLFLFFV.TMFFISVLSLFS.HCWL
Retrocopy
NI*RVHHCSACDICVLKMDHHCPWVNNCVGFSNYKLFLLF----LLYCLFIATTVLQCFIKFWTNELSATRAKFHVLFLFFVFTMFFISVLSLFSHHCWL


Parental protein
VGKNRTTIESFRAPTFSYGPDGNGFSLGCSKNWRQVFGDEKKYWLLPIFSSLGDGCSFPTRLVGMDPEQASVSNQNEYARSIGSNQPFPVKPLSESKNRL
VGKNR.TIESFRAPTFSYGPDGNGFSLGCSKNWRQVFGDEKKYWLLPIFSSLGDGCSFPT.LVGMDPEQASVSNQN.YARSIGSNQPFPVKPLSESKNRL
Retrocopy
VGKNR-TIESFRAPTFSYGPDGNGFSLGCSKNWRQVFGDEKKYWLLPIFSSLGDGCSFPTLLVGMDPEQASVSNQNKYARSIGSNQPFPVKPLSESKNRL


Parental protein
LDSESQWLENGSEESTVRSGTNNHVTVAIEN
LDSESQWLENGSE.STVRSGTNNHVTVAIEN
Retrocopy
LDSESQWLENGSEKSTVRSGTNNHVTVAIEN


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide