RetrogeneDB ID:
retro_ecab_688
Organism:
Horse ( Equus_caballus )
Location:
28:29004011-29004308 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
64.15 %
Coverage:
60.48 %
Frameshifts:
5
Stop codons:
2


Parental gene:
Parental gene symbol:
GTSF1
Parental gene aliases:
No gene alias available
Parental gene description:
gametocyte specific factor 1 [Source:HGNC Symbol;Acc:26565]

Genomic region (view in browser)





>retro_ecab_688
AATGTCACAAACAAATTGGCTACTTGTCCTTTCAATGCTCGCCACCAGGTTCCTTGACCG
AAATCAGTCATCGTATCTCAAGCTGTGATGACAAACTTGTATTGATCAGGATGTTGTCCA
CTAACCCAGGAAACCTGGATAAGGGCTCTGGCTGAGAGCACATGGCAGTGCCCTCCTTGG
ATGAAGTCTGGCATAAAGATTTGTGGAAACAGACCAGCACACCATGTCTAGGGCTCAGCC
AATTACTGTGGCAAGAACAGCCCTGCCAGCAACATACTTATGGAACATTAGAGTAAT

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.06

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
DVANKLATCPFNARHQVP-RAEISHHISSCDDK-SCIEQDVVNQTRNLG-QETLAESTWQCPP-CDEDWDKDLWEQTSTPFVWGTTNYCGNNSP-ASNIV
.V.NKLATCPFNARHQVP...EISH.ISSCDDK..CI.QDVV...R..G....LAESTWQCPP..DE.W.KDLW.QTSTP...G.........P.ASNI.
Retrocopy
NVTNKLATCPFNARHQVP/LTEISHRISSCDDK/TCIDQDVVH*PRKPG/IRALAESTWQCPP/LDEVWHKDLWKQTSTPCL-GLSQLLWQEQP\ASNIL


Parental protein
MEHKSN
MEH.SN
Retrocopy
MEH*SN


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide