RetrogeneDB ID:
retro_ecab_694
Organism:
Horse ( Equus_caballus )
Location:
28:20728439-20729423 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
70.41 %
Coverage:
77.44 %
Frameshifts:
5
Stop codons:
2


Parental gene:
Parental gene symbol:
GOT2
Parental gene aliases:
No gene alias available
Parental gene description:
glutamic-oxaloacetic transaminase 2, mitochondrial [Source:HGNC Symbol;Acc:4433]

Genomic region (view in browser)





>retro_ecab_694
ATGGCCTTGCAGTGCTCTGGCTGCATCCTGTCTGGGGTCCTGCCGCCCTCCACCCAGGCC
TCGCTGTGGCAGCCTCTGCCAGATCCATCTCAGTGGGAGATGGGACCCCCAGATCCCATC
CTAGGAGTCACAGGAATCTGTAAGAGAGACACCAACAGCAAAAAGATGAATCTAGGAGGT
GGTGCCTACTGCGATGATAGTGGAAAGCCTTACATGATCCCTAGCTTCCGGAAGGCAGAG
GCCCAGATTGGTGCAAAAAAAATGGACAAAGAATACCTGTCCATTGTGAGACTGGCTGAA
TTTTGTAAGGTTTCTGCAAAATTAGCCCTGGGTGAGAACAGCAGAGTGCTGAAAAGTGAC
CAGTATGTCACTGTGCAGACCATTTCTGGAACTGAGGCCCTAAGGACCGCAGCCAGTTTT
CTGCAAAGATTTTTAAAGTTCAGCCGAGATGTCTTTCTGCCCAAACATCCTGGGAAAATC
ATACACCCATCCTCAGGGACGCTGGATGCAGCTACATGGTTATTGATACTGTGACCCCAA
GACTTGTAGCTTTGACTTCACAGTGCTATGAAGGACACTTTAAAAATGCCAGAGCAAAGT
GTTTTTCTCCTGCATGACCATGTCCACAATCCCAGGCGAGTGGACCCTCATTCTAAGCAG
TGGAAGGAAATAGCAACGGTAGTGAGGAAACAGAATCTCTTTTCGTTCTTTGAAGTGGCC
TACCAAGGCTTTGCCGGTGGTGATGGTAACAAGGATGCCTGGGCAGTGCGCCACTTCATT
GAAGAGGGCATTAATATTTGTCTCTTCCAATCCTTTGCCAAGAACGTGGACTTATATGGT
GACTGTGTGGGAGCCTTCACTGTGGTCTGCGAAGATGCTGATGAAGCCAAAAGGGGGGAG
TGACAGTTGAAGATCTTGATCCGTTCCACGTATTCCAACCCTCTTCTCAAAGGGGCCCGG
ATTGCCTCAACCATTCTGACAGCT

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.12
SRP021940_cerebellum 0.1
SRP021940_embryo 0.05
SRP021940_placental_villous 0.49
SRP021940_synovial_membrane 0.29
SRP021940_testis 0.12

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MALLHSGRVLSGVA-SAFHPGLAAAASARA-SSWWAHVEMGPPDPILGVTEAYKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAAKNLDKEYLP
MAL..SG..LSGV...A.HPGLA.AASAR..S.W....EMGPPDPILGVT...KRDTNSKKMNLG.GAY.DD.GKPY..PS.RKAEAQI.....DKEYL.
Retrocopy
MALQCSGCILSGVL/AALHPGLAVAASARS\SQW----EMGPPDPILGVTGICKRDTNSKKMNLGGGAYCDDSGKPYMIPSFRKAEAQIGXXXXDKEYLS


Parental protein
IGGLAEFCKASAELALGENSEALKSGRYVTVQSISGTGALRIGANFLQRFFKFSRDVFLPK-PSWGNHTPIFRDAG-LQLHAYRYYDPKTCGFDVT-GAL
I..LAEFCK.SA.LALGENS..LKS..YVTVQ.ISGT.ALR..A.FLQRF.KFSRDVFLPK..SW.NHTPI.RDAG..QLH.Y.Y.DPKTC.FD.T..A.
Retrocopy
IVRLAEFCKVSAKLALGENSRVLKSDQYVTVQTISGTEALRTAASFLQRFLKFSRDVFLPK/TSWENHTPILRDAG/MQLHGY*YCDPKTCSFDFT/SAM


Parental protein
EDISKIPQQSIILLHACAHNPTGVDPRPEQWKEIATLVKKNNLFAFFDMAYQGFASGDGDKDAWAVRYFIEQGINVCLCQSYAKNMGLYGERVGAFTMVC
.D..K.P.QS..LLH...HNP..VDP...QWKEIAT.V.K.NLF.FF..AYQGFA.GDG.KDAWAVR.FIE.GIN.CL.QS.AKN..LYG..VGAFT.VC
Retrocopy
KDTLKMPEQSVFLLHDHVHNPRRVDPHSKQWKEIATVVRKQNLFSFFEVAYQGFAGGDGNKDAWAVRHFIEEGINICLFQSFAKNVDLYGDCVGAFTVVC


Parental protein
KDADEAKRVESQLKILIRPLYSNPPLNGARIASTILTS
.DADEAKR.E.QLKILIR..YSNP.L.GARIASTILT.
Retrocopy
EDADEAKRGE*QLKILIRSTYSNPLLKGARIASTILTA


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide