RetrogeneDB ID:
retro_ecab_696
Organism:
Horse ( Equus_caballus )
Location:
29:16920086-16920368 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
68.09 %
Coverage:
62.25 %
Frameshifts:
0
Stop codons:
2


Parental gene:
Parental gene symbol:
RPS13
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein S13 [Source:HGNC Symbol;Acc:10386]

Genomic region (view in browser)





>retro_ecab_696
CACAGGGTATTGCACAAGGATGTTGTGACAGGCAATGAAATCTTGAGAACCGTTAAGTCC
CAACGATTTGCTCCTGATCTACCTGAGGATCTCTGTCACTTAATTAAGAAAGCTGTTGCC
ATTCAAAAGCATCTTGAGAAGGACAGAAAGGACAGGGATGTTAAATTCCATCTGATTCTG
ATTGAGAGCCATATTTACTGTTTGGCTTGACATCATAAGACCAAGTGATCCCTCCCCCCA
AATTGGAAATATGAATTATCCACAGCCTCTATGCTGGTGGCA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
HGVAQVRFVTGNKILRILKSKGLAPDLPEDLYHLIKKAVAVRKHLERNRKDKDAKFRLILIESRIHRLARYYKTKRVLPPNWKYESSTASALVA
H.V.....VTGN.ILR..KS...APDLPEDL.HLIKKAVA..KHLE..RKD.D.KF.LILIES.I..LA...KTK..LPPNWKYE.STAS.LVA
Retrocopy
HRVLHKDVVTGNEILRTVKSQRFAPDLPEDLCHLIKKAVAIQKHLEKDRKDRDVKFHLILIESHIYCLA*HHKTK*SLPPNWKYELSTASMLVA


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide