RetrogeneDB ID:
retro_ecab_697
Organism:
Horse ( Equus_caballus )
Location:
29:29327535-29327981 (+)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
93.33 %
Coverage:
100.0 %
Frameshifts:
1
Stop codons:
0


Parental gene:
Parental gene symbol:
MCTS1
Parental gene aliases:
No gene alias available
Parental gene description:
malignant T cell amplified sequence 1 [Source:HGNC Symbol;Acc:23357]

Genomic region (view in browser)





>retro_ecab_697
TTCCCAGGCGTGGAGCCCTGGCTGCATCAGATCATGCCCAAGAAGGACCCGGTCAAGATC
GTGCGGTGCCACGAGCACATAGAGATCCTGACCGTCAACGGGGAGCTGCTGTTCTTCAGA
CAGAGAGAGGGGCCTTTCTATCCGACTCTGAGGCTGCTCCACAAGTACCCCTTCATCCTG
CGCGCCAGCAGGTGGATAAGGGCGCCATCAAGTTCGTGCTCAGCGGCGCCAACATCATGT
GTCCCGGCCTGACCTCCCCCGGGGCTCAGCTCTACCCCGCTGCGGAAGACACGGTGGTCG
CGATCATGGCGGAGGGCAAGCAGCACGCCCTGTGTGTGGGCGTCATGAAGATGTCTGCAG
AAGACATCGGGAAGGTCAACAAAGGCATCGGCATTGAAAACATCCACTATTTAAATGATG
GGCTGTGGCATATGAAGACGTATAAA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 4.88
SRP021940_cerebellum 27.43
SRP021940_embryo 21.11
SRP021940_placental_villous 10.73
SRP021940_synovial_membrane 9.17
SRP021940_testis 72.45

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
FPVIEPWLNQIMPKKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFIL-PHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTI
FP..EPWL.QIMPKKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFIL...QQVDKGAIKFVLSGANIMCPGLTSPGA.LYPAA.DT.
Retrocopy
FPGVEPWLHQIMPKKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFIL/ARQQVDKGAIKFVLSGANIMCPGLTSPGAQLYPAAEDTV


Parental protein
VAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTYK
VAIMAEGKQHALCVGVMKMSAEDI.KVNKGIGIENIHYLNDGLWHMKTYK
Retrocopy
VAIMAEGKQHALCVGVMKMSAEDIGKVNKGIGIENIHYLNDGLWHMKTYK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide