RetrogeneDB ID:
retro_ecab_70
Organism:
Horse ( Equus_caballus )
Location:
14:62789984-62790635 (-)
Status:
KNOWN_PROTEIN_CODING
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
93.02 %
Coverage:
98.62 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
SOD2
Parental gene aliases:
SOD2, Mn-SOD
Parental gene description:
superoxide dismutase [Source:RefSeq peptide;Acc:NP_001075986]

Genomic region (view in browser)





>retro_ecab_70
ATGTTGTGCCGGGCGGAGTGCAGCACGAGCAGGAAGCTGGTGCCAGCTCTGGGGTCCCAG
CAGAAGCACAGCCTCCCCGACTTGCAGTATGATTATGGCACCCTGGAGCCCTACATCAAT
GCCCAGATCATGCAGCTGCACCACAGCAAGCACCACGCGGCCTATGTGAACAACCTGAAC
GTCACCAAGGAGAAGTACAAGGAGGCGCTGGCCAAGGGGGACGTGACAGCTCAGACTGCT
TTGCAGCCTGCACTGAAGTTCAATGGTGGAGGCCATATCAATCATACCATTTTCTGGACA
AACCTGAGCCCCAATGGCGGGGGAGAACCCAAAGGGCAATTGCGGGACGCCAACTTTGGT
TCCTTCGACAAATTTAAACAGAAGTTGACCGCTGTATCGGCTGGTGTCCAAGGCTCGGGT
TGGGGTTGGCTCGGTTTCAATAAGGACCAGGGACGTCTCCAGATTGTTGCCTGTCCTAAC
CAGGATCCCCTGCAGGGAACAACAGGTCTTATTCCCCTGCTGGGGATTGACGTGTGGGAG
CACGCTTATTACCTTCAGTATAAAAACGTCAGGCCTGATTATCTGAAAGCCATTTGGAAT
GTGATCAACTGGGAGAATGTATCTGAGAGATACATGGCTTGCAAAAAGTAA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 2.9
SRP021940_cerebellum 2.39
SRP021940_embryo 0.57
SRP021940_placental_villous 1.97
SRP021940_synovial_membrane 3.83
SRP021940_testis 0.89

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
STSRKLVPALGSLGSRQKHSLPDLQYDYGALEPYINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHTIFWTNLSP
STSRKLVPA...LGS.QKHSLPDLQYDYG.LEPYINAQIMQLHHSKHHAAYVNNLNVT.EKY.EALAKGDVTAQ.ALQPALKFNGGGHINHTIFWTNLSP
Retrocopy
STSRKLVPA---LGSQQKHSLPDLQYDYGTLEPYINAQIMQLHHSKHHAAYVNNLNVTKEKYKEALAKGDVTAQTALQPALKFNGGGHINHTIFWTNLSP


Parental protein
NGGGEPKGELLDAIKRDFGSFDKFKEKLTAVSAGVQGSGWGWLGFNKDQGRLQIVACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNV
NGGGEPKG.L.DA....FGSFDKFK.KLTAVSAGVQGSGWGWLGFNKDQGRLQIVACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNV
Retrocopy
NGGGEPKGQLRDA---NFGSFDKFKQKLTAVSAGVQGSGWGWLGFNKDQGRLQIVACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNV


Parental protein
INWENVSERYMACKK
INWENVSERYMACKK
Retrocopy
INWENVSERYMACKK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide