RetrogeneDB ID:
retro_ecab_703
Organism:
Horse ( Equus_caballus )
Location:
29:16595544-16595851 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
66.67 %
Coverage:
88.79 %
Frameshifts:
2
Stop codons:
1


Parental gene:
Parental gene symbol:
ZAR1
Parental gene aliases:
No gene alias available
Parental gene description:
zygote arrest 1 [Source:HGNC Symbol;Acc:20436]

Genomic region (view in browser)





>retro_ecab_703
CAGTTCTTACAGCAGCAACGCGGTTGTCGTCGCTGCAAGGACTGCAGCATCCGATGGGAA
AGTGCCTACGTGGGGAGGGTACGGGGCACTAACGAGGTTAACTTCAAGCGGTTTTGCAGA
ACTTCGCAGAAGTCTTATAACCTTGTTGAGCGGAGGGTAGCGCCTGTCCTAGTTTTAAAC
AGACTAGCTCCACCTGCCCCGTAAAACTTCGCCACGTCGACCCTAAAAGGCTCCGTCGTC
AAGATCGGTGTGGGAGATGCAAGGCAAAGGCCTCCCCTGTGACCGCACTTTCAGCTTGAA
ATATATC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
QFLEQKYGYYHCKDCNIRWESAYVWCVQGTNKVYFKQFCRTCQKSYN-PYRVEDITCQSCKQTRCSCPVKLRHIDPKRPHRQDLCGRCK-GKRLSCDSTF
QFL.Q..G...CKDC.IRWESAYV..V.GTN.V.FK.FCRT.QKSYN.P...E...C.S.KQT...CPVKLRH.DPKR..RQD.CGRCK.GK.L.CD.TF
Retrocopy
QFLQQQRGCRRCKDCSIRWESAYVGRVRGTNEVNFKRFCRTSQKSYN/PC*AEGSACPSFKQTSSTCPVKLRHVDPKRLRRQDRCGRCK/GKGLPCDRTF


Parental protein
SFKYI
S.KYI
Retrocopy
SLKYI


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide