RetrogeneDB ID:
retro_ecab_704
Organism:
Horse ( Equus_caballus )
Location:
29:25133517-25133846 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
69.37 %
Coverage:
53.92 %
Frameshifts:
1
Stop codons:
1


Parental gene:
Parental gene symbol:
BCL7C
Parental gene aliases:
No gene alias available
Parental gene description:
B-cell CLL/lymphoma 7C [Source:HGNC Symbol;Acc:1006]

Genomic region (view in browser)





>retro_ecab_704
TTGCAAAAGGGCACTGAGCTCGGTGCTGGGGGCCTGCCCCTAGCCAGCTACCCTGTGTCA
CCTGCCAAACCACTGGAAGGGGTCCCAGAGGATGCTCAGCCTCCATGGCTGGGCCAAGAG
AGAGATCTCAGGGGCATAATAACAGGTGGCACTGATAAACCCCCAAAGTGACCCAGGAGG
AGTCTGTTCCAGAACTGCTGGAGGATGAGGCCACTGAAGCTTAGCCCATCCTTGAGCCAC
TGCTATATGTGCCTGAGGCAGCCCAGGGTGACACAGAGGACTCGGAGGACATCCCTCCAC
TCAAGCGCGTCTGCCCAGATATCCCCAAC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
LQKGTEPSPGGTPQPSRPVSPAGPPEGVPEDAQPPRLGQERDPGGITAGGTDEPPM-LTKEEPVPELLEAEAPEAYPVFEPVPPVPEAAQGDTEDSEGAP
LQKGTE...GG.P..S.PVSPA.P.EGVPEDAQPP.LGQERD..GI..GGTD.PP...T.EE.VPELLE.EA.EA.P..EP...VPEAAQGDTEDSE..P
Retrocopy
LQKGTELGAGGLPLASYPVSPAKPLEGVPEDAQPPWLGQERDLRGIITGGTDKPPK/VTQEESVPELLEDEATEA*PILEPLLYVPEAAQGDTEDSEDIP


Parental protein
PLKRICPNAPD
PLKR.CP..P.
Retrocopy
PLKRVCPDIPN


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide