RetrogeneDB ID:
retro_ecab_705
Organism:
Horse ( Equus_caballus )
Location:
29:33241530-33242105 (-)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
87.56 %
Coverage:
100.0 %
Frameshifts:
1
Stop codons:
0


Parental gene:
Parental gene symbol:
RAC2
Parental gene aliases:
No gene alias available
Parental gene description:
ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2) [Source:HGNC Symbol;Acc:9802]

Genomic region (view in browser)





>retro_ecab_705
ATGCAGGCCATCAAGTGTGCGGTGGTGGAAGACGGAGCTGTAGGTAAGACGTGCCTGCTG
ATCAGTTACACGACCAATGTGTTTCCCGGAGAGTACATCCCCACCGTCTTTGACAACTAT
TCTGCCAGTGTTATGGTAGATGGAAAACCAGTGAATCTGGGCTTGTGGGATACAGCTGAA
CAAGAAGATTACGACAGATTGCGTCCCCTCTCCTACCCGCAAACAGACGTCTTCTTAATT
TGCTTTTCTCTTGTGAGTCCTGCATCATTTGAAAATGTCCGTGCAAAGTGGTATCGTGAA
GTGCGACACCATTGTCCCAACACTCCCATCATCCTGGTGGGGACTAAACTTGATCTTAGG
GATGACAAGGACACGATCGAGAAACTGAAGGAGAAGAAGCTGACTCCCATCACCTACCCG
CAGGGCCTACCATGGCCAAGGAGATCGGTGCTGTCAAATACCTGGAGTGCTCGGCGCTCA
CACAGCGAGGCCTCAAGACAGTGTTGGATGAAGCTATTCGAGCGGTTCTCTGCCCGCCTC
CCGTCAAGAAGAGGAAAAGGAAATGCCTGCTGCTG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 8.77
SRP021940_cerebellum 16.98
SRP021940_embryo 11.5
SRP021940_placental_villous 19.09
SRP021940_synovial_membrane 13.7
SRP021940_testis 6.17

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWYPE
MQAIKC.VV.DGAVGKTCLLISYTTN.FPGEYIPTVFDNYSA.VMVD.KPVNLGLWDTA.QEDYDRLRPLSYPQTDVFLICFSLVSPAS.ENVRAKWY.E
Retrocopy
MQAIKCAVVEDGAVGKTCLLISYTTNVFPGEYIPTVFDNYSASVMVDGKPVNLGLWDTAEQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYRE


Parental protein
VRHHCPSTPIILVGTKLDLRDDKDTIEKLKEKKLAPITYPQGL-ALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQPTRTQKRPCSIL
VRHHCP.TPIILVGTKLDLRDDKDTIEKLKEKKL.PITYPQGL...AKEI..VKYLECSALTQRGLKTV.DEAIRAVLCP.P....KR.C..L
Retrocopy
VRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGL/TMAKEIGAVKYLECSALTQRGLKTVLDEAIRAVLCPPPVKKRKRKCLLL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide