RetrogeneDB ID:
retro_ecab_706
Organism:
Horse ( Equus_caballus )
Location:
3:6532015-6532260 (+)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
75.0 %
Coverage:
51.55 %
Frameshifts:
1
Stop codons:
1


Parental gene:
Parental gene symbol:
ATP5H
Parental gene aliases:
No gene alias available
Parental gene description:
ATP synthase, H+ transporting, mitochondrial Fo complex, subunit d [Source:HGNC Symbol;Acc:845]

Genomic region (view in browser)





>retro_ecab_706
GCTGGGCAAAAACTTGCTCTAAACGCCATTGACTGGGTAGCTTTTGGGGAGATCAAACCC
TGAAACCAGAAGCCATTGCCAACTCCCTGAAATCCTGGAATGAGAGCCTCACCTCCAGGT
TGGCTACTCTGCCTAACTCCACCCGCTATCGATGGCCATGCTACAAGGCCGGCGTGGTGG
AGGCGGGCTTGGTAGATGACTTTGAGAAGAAGTTTAACGCCCCGAAGATGCCTGTGCCAG
GGGAT

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.06
SRP021940_cerebellum 0.0
SRP021940_embryo 0.07
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.03
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
AGRKLALKAIDWVAFGEIIPRNQK-AIANSLKSWNETLTSRLATLPEAPPAIDWAYYKANVAKAGLVDDFEKKFNALKVPVPED
AG.KLAL.AIDWVAFGEI.P.NQK.AIANSLKSWNE.LTSRLATLP.......W..YKA.V..AGLVDDFEKKFNA.K.PVP.D
Retrocopy
AGQKLALNAIDWVAFGEIKP*NQK/AIANSLKSWNESLTSRLATLPNS-TRYRWPCYKAGVVEAGLVDDFEKKFNAPKMPVPGD


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide