RetrogeneDB ID:
retro_ecab_707
Organism:
Horse ( Equus_caballus )
Location:
3:7730203-7730914 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
68.35 %
Coverage:
87.92 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
CAPNS1
Parental gene aliases:
No gene alias available
Parental gene description:
calpain, small subunit 1 [Source:HGNC Symbol;Acc:1481]

Genomic region (view in browser)





>retro_ecab_707
AATGGAGGCCTTGGAGAAGCTCTTGGAGGCCTTCTTGGAGGAGGCGGTCAGAAAAGAGGA
GGAGGAGGAAATATTGGAGCGATAGTTGGGGGAATTATGAATTTTATCAGTGAGGCTGCA
GCAGCCCAGTATACCCCCGAGCCGCCGCCATCCACTCAGCAGCATTTCACCACCGTGGAG
GCCAACGAAAGTGAGGAGGTGCGGCAGTTTCGGCAACAGTTTGCGCGACTGGCTGGACCC
GACATGGAGGTGGGTGCCACTGACCTGATGAACATTCTCAACAAAGTCCTCGCTAAGCAC
AAGGATCTGAAGTCGGACGGCTTCAGTCTTGACACCTGCCGGAGCATTGTATCCGTTATG
GACAGTGACACGAATGGGAAGCTGGGCTTTGAAGAATTTAAGTACTTCTGGAACAACATC
AAGAAGTGGCAGTGTGTTTTCAGGCAACATGACACGGACCGTTCCGGGTCTCTGAGGAGT
TCCCAGCTGAAGGGGGCTCTGCAGGCGGCAGGTTTCCAGCTAAACGAGCAGCTCTACCGA
ATGATCGTCCGCCGCTACGCCGATGAGAATGGAAGCATGGATTTTAACAACTTCATCAGC
TGCCTGGTCCGCCTGGATGCCATGTTCCGTGCCTTCAAATCTCTGGATAGAAATGCAAGT
GGCCTGATTGAGGTGTCTATCCAGGAGTGGCTGCAGCTGACCATGTACTCC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.05
SRP021940_embryo 0.98
SRP021940_placental_villous 8.32
SRP021940_synovial_membrane 0.16
SRP021940_testis 0.06

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
SGGGGGGGGG--GGGGGGGGGGGTAMRILGGVISAISEAAA-QYNPEPPP-PRTHYSNIEANESEEVRQFRRLFAQLAGDDMEVSPTELMNILNKIVTRH
.GG.G...GG..GGGG...GGGG....I.GG....ISEAAA.QY.PEPPP....H....EANESEEVRQFR..FA.LAG.DMEV..T.LMNILNK....H
Retrocopy
NGGLGEALGGLLGGGGQKRGGGGNIGAIVGGIMNFISEAAAAQYTPEPPPSTQQHFTTVEANESEEVRQFRQQFARLAGPDMEVGATDLMNILNKVLAKH


Parental protein
PDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKKWQAIYKQFDMDRSGTIGSSELPGAFQAAGFHLNEHLYNMIIRRYSDEGGNMDFDNFIS
.DLK.DGF..DTCRS.V.VMDSDT.GKLGFEEFKY.WNNIKKWQ....Q.D.DRSG...SS.L.GA.QAAGF.LNE.LY.MI.RRY.DE.G.MDF.NFIS
Retrocopy
KDLKSDGFSLDTCRSIVSVMDSDTNGKLGFEEFKYFWNNIKKWQCVFRQHDTDRSGSLRSSQLKGALQAAGFQLNEQLYRMIVRRYADENGSMDFNNFIS


Parental protein
CLVRMDAMFRAFKSLDKDGSGQIQVNIQEWLQLTMYS
CLVR.DAMFRAFKSLD...SG.I.V.IQEWLQLTMYS
Retrocopy
CLVRLDAMFRAFKSLDRNASGLIEVSIQEWLQLTMYS


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide