RetrogeneDB ID:
retro_ecab_709
Organism:
Horse ( Equus_caballus )
Location:
3:12436917-12437397 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
56.1 %
Coverage:
68.8 %
Frameshifts:
2
Stop codons:
4


Parental gene:
Parental gene symbol:
STARD3NL
Parental gene aliases:
No gene alias available
Parental gene description:
STARD3 N-terminal like [Source:HGNC Symbol;Acc:19169]

Genomic region (view in browser)





>retro_ecab_709
AAGGAAACGAGTGGCATATCCAGTGTCTGAAGGACTTTCTATTTGTTTATCACCTTTGAT
TTCTTAACTGTAAACTTAACAGGAAAAACATAGTTGAATACAAATAGAAAAATAGAAAAA
GTTTTAGTGAAGGAGAGAGGGCAGTATGTTTAGTATTTCCTTTATTCCAGTGGATTTCTT
TCGAAAATATTTAATTGGAAGCATTAATGCTTGCATATGCAGTATGTAACTACCACAAGC
AGGCTGTGGCATTGGCGATGGCAGTGACCATGGTCTTTTTTATTAGCACAGGTGTTCCTC
TCCTAGCTTTTCTCTCAGGGTGCTTTCGGATCTGTGCTGCCTATTTCATTGATACTTTCC
TGGACTGAGATCTGGTGCATGGATTTCAAAGTCTTGACACAAGGAACAGAAGTGGAAATC
AGATCCCTCTTAGTTCAGGATGCCTCAGAGAAAGCAAGCTTTATACAACCTTGTGGTCTT

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
REKKGISDVRRTFCLFVTFDLLFVTLLWIIELNVNGGIENTLEKEVVQYDYYSSYFDIFLLAVFRFK-VLILAYAVCRLRHWWAIALTTAVTS-AFLLAK
.E..GIS.V.RTF.LF.TFD.L.V.L.....LN.N..IE..L.KE..QY..Y..Y...FL...F..K..L.LAYAVC...H..A.AL..AVT...FLLA.
Retrocopy
KETSGISSV*RTFYLFITFDFLTVNLTGKT*LNTNRKIEKVLVKERGQYV*YFLYSSGFLSKIFNWK/ALMLAYAVCNY-HKQAVALAMAVTM\SFLLAQ


Parental protein
VILSKLFSQGAFGYVLPIISFILAWIETWFLDFKVLPQEAEEENRLLIVQDASERAALI-PGGL
V.LS.LFSQGAFG.VLPI.S.IL.W.E.W..DFKVL.Q..E.E.R.L.VQDASE.A..I.P.GL
Retrocopy
VFLS*LFSQGAFGSVLPI-SLILSWTEIWCMDFKVLTQGTEVEIRSLLVQDASEKASFIQPCGL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide