RetrogeneDB ID:
retro_ecab_711
Organism:
Horse ( Equus_caballus )
Location:
3:32072072-32072329 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
52.87 %
Coverage:
88.54 %
Frameshifts:
1
Stop codons:
0


Parental gene:
Parental gene symbol:
SEC61B
Parental gene aliases:
No gene alias available
Parental gene description:
Sec61 beta subunit [Source:HGNC Symbol;Acc:16993]

Genomic region (view in browser)





>retro_ecab_711
GTGGGCCGGGCCCTGGTGGACCCGCACAGGCTCCTCGGAGCCCTCCCAGTGGGGTCCCGG
GCTGCCCCGGGCAGAGGAAGAAGCCGGCGTGGGACGGGGAGCGCAGGCCGCACGACCTTG
GCAGGCTCTGGGGGGCCGGGGCGATCCTGCACAGAGGGTCACCGGGCCTCAGCGTCGGCC
CTGTGCCATTACTGGTTGTGAGTCTTCTGATCGCTGCTTCTGTATTTATGTCGCACATTT
GGAGCAAGGACATTCGG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.23
SRP021940_cerebellum 0.2
SRP021940_embryo 0.02
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.08
SRP021940_testis 0.06

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
VGSSGRSPSKAVAARAAGSTVRQRKNASC-GTRSAGRTTSAGTGGMWRFYTED-SPGLKVGPVPVLVMSLLFIASVFMLHIWGKYTR
VG.....P.....A...GS........S..GT.SAGRTT.AG.GG..R..TE..SPGL.VGPVP.LV.SLL..ASVFM.HIW.K..R
Retrocopy
VGRALVDPHRLLGALPVGSRAAPGRGRSRRGTGSAGRTTLAGSGGPGRSCTEG/SPGLSVGPVPLLVVSLLIAASVFMSHIWSKDIR


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide