RetrogeneDB ID:
retro_ecab_713
Organism:
Horse ( Equus_caballus )
Location:
3:38370784-38371481 (+)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
61.22 %
Coverage:
75.71 %
Frameshifts:
5
Stop codons:
0


Parental gene:
Parental gene symbol:
EIF3G
Parental gene aliases:
No gene alias available
Parental gene description:
eukaryotic translation initiation factor 3, subunit G [Source:HGNC Symbol;Acc:3274]

Genomic region (view in browser)





>retro_ecab_713
ATTGTCCACAGCTTCAGAATTGAGATCTAGAAGAGCTCAAAGGCCATTTCAAGGAGGAAG
AACTGGAAGAAGTTTGGGAACTCAAAGTTTGACCAATGTGGCCACCAGCACAGTCAGTGG
TGATGTGCCCGTGACTGTTCATCAAAGAGGATTTGAACTGCCAGGAGGACCCGATGAACA
AGCTCAAGGGCCAGAAGGTTGAGTTCTGCCGCATCTGCAAGGCAACAACTGGAGGACTCG
TTGCCCCACACAAGGATACACTGTGGCCCGTGCAAAAGGAGCTGGCCGAGAAGGTGGGAC
TGTCCACTGGCAAGAAGGCAAAGTTGCCCAAACAGTTGGACCCTATGTATACAGCCCAAA
ACAAGACAGGGAAGTATGTGCCATGAGCCTGCGGGTCAGGGCCAGCCACTGTGGGAAGTC
CACACAGCCCAATCACACAGTTGATGACAATGCCATCATCTTCGTTTCCACCCTGTCAGA
GGACACTCATGATACTGACCTGCAGGAGCTCTTCCAGTCCTTTGGCTCCATCTTATGCAT
CTACCTGGCAAAGGACAAGACCACTGGCCAGTCCAAGGGCTTTGCCGTCATCAGATTTCA
CAGCTATGAGGACACCTCAAGTGCCCTTGCTGACATGTCCAGCTGTGGCTGTGACCACCT
CATCCTCAGTGTCAAGTGGGTCAAGCCCTCAACCAAC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.05
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
IVRTFRIE-TRKASKAVARRKNWKKFGNSEFDPPGPNVATTTVSDDVSMT-FITSKEDLNCQEEEDPMNKLKGQKIVSCRICK-GDHWTTRCP-YKDTLG
IV..FRIE..R.A.............G.........NVAT.TVS.DV..T.FI..KEDLNCQE..DPMNKLKGQK...CRICK.G..W.TRCP..KDTL.
Retrocopy
IVHSFRIE\SRRAQRPFQGGRTGRSLGTQSLT----NVATSTVSGDVPVT\FI--KEDLNCQE--DPMNKLKGQKVEFCRICK/GNNWRTRCP\HKDTLW


Parental protein
PMQKELAEQLGLSTGEKEKLPGELEPVQATQNKTGKYVP-PSLRDGASRRGESMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGSISRIYLAKDKT
P.QKELAE..GLSTG.K.KLP..L.P....QNKTGKYVP..SLR..AS..G.S.QPN...DDNA.I.V..LSEDT..TDLQELF..FGSI..IYLAKDKT
Retrocopy
PVQKELAEKVGLSTGKKAKLPKQLDPMYTAQNKTGKYVP/MSLRVRASHCGKSTQPNHTVDDNAIIFVSTLSEDTHDTDLQELFQSFGSILCIYLAKDKT


Parental protein
TGQSKGFAFISFHRREDAARAIAGVSGFGYDHLILNVEWAKPSTN
TGQSKGFA.I.FH..ED...A.A..S..G.DHLIL.V.W.KPSTN
Retrocopy
TGQSKGFAVIRFHSYEDTSSALADMSSCGCDHLILSVKWVKPSTN


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide