RetrogeneDB ID:
retro_ecab_716
Organism:
Horse ( Equus_caballus )
Location:
3:56672232-56672433 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
75.0 %
Coverage:
66.67 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
HSPE1
Parental gene aliases:
No gene alias available
Parental gene description:
heat shock 10kDa protein 1 (chaperonin 10) [Source:HGNC Symbol;Acc:5269]

Genomic region (view in browser)





>retro_ecab_716
AAAAAATCTCAAGAAAAAGTATTGCAATCGACAGTAGTAGCTGTTGACTTGAGCTCTAAT
GGCAAGGGTGGAGAGATTCAACCAGTAAGCATGTACGTTAGAGATAAAATTTTCCCAGAA
TATGGAGGCATCAAAGTAGCTCTGGATGACAAGGATTATTTCTTCTTTAGAGGTGGTGAC
ATTCTTGGAAAGTATGTAGAC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.06
SRP021940_cerebellum 0.1
SRP021940_embryo 0.34
SRP021940_placental_villous 1.16
SRP021940_synovial_membrane 0.89
SRP021940_testis 0.12

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
EKSQGKVLQATVVAVGAGSKGKGGEIQPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD
.KSQ.KVLQ.TVVAV...S.GKGGEIQPVS..V.DK...PEYGG.KV.LDDKDYF.FR.GDILGKYVD
Retrocopy
KKSQEKVLQSTVVAVDLSSNGKGGEIQPVSMYVRDKIF-PEYGGIKVALDDKDYFFFRGGDILGKYVD


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide