RetrogeneDB ID:
retro_ecab_720
Organism:
Horse ( Equus_caballus )
Location:
3:61904142-61904475 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
58.97 %
Coverage:
58.38 %
Frameshifts:
2
Stop codons:
3


Parental gene:
Parental gene symbol:
C11orf73
Parental gene aliases:
No gene alias available
Parental gene description:
chromosome 11 open reading frame 73 [Source:HGNC Symbol;Acc:26938]

Genomic region (view in browser)





>retro_ecab_720
AAAATTGCATGCCTTAAATCTGGAGAAGGAAGCCGACACCCCTCTGGAGCCATGAATATT
GTCCAGACTCCATCTGTTGCTCTGATTGGAATTTCAGCAGATTTACAGACTCAGACTGCT
GTGGGGGATGCTGCTGACTCCTTAGCTGATTCATTCACTCAGCCATCCATGAAACGTGGG
GCAATGTCTACTGCTCTGCTTCATCATTTGCTCTTTCTGAGGCCTAGATGACACCAAATC
CATCTGAATTTTTCATTCCAGCAAGTGAGGCTCAGCCAACGTTATGAAAATTTTCAAAGA
TGACTAACATTGAGTCCTCTCCTCTGAAAAACA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.06

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
KISGLKSGEGSQHPFGAMNIVRTPSVAQIGISVELLDSLAQQTPVGNAAVSSVDSFTQFTQK-MLDNFYNFASSFAVSQAQMTPSPSEMFIPANV-VLKW
KI..LKSGEGS.HP.GAMNIV.TPSVA.IGIS..L....A....VG.AA.S..DSFTQ...K....N.Y..ASSFA.S.A.MTP.PSE.FIPA.......
Retrocopy
KIACLKSGEGSRHPSGAMNIVQTPSVALIGISADLQTQTA----VGDAADSLADSFTQPSMK/TWGNVYCSASSFALSEA*MTPNPSEFFIPASE\LSQR


Parental protein
YENFQRRLAQNPLFWKT
YENFQR.L...PL..KT
Retrocopy
YENFQR*LTLSPLL*KT


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide