RetrogeneDB ID:
retro_ecab_721
Organism:
Horse ( Equus_caballus )
Location:
3:64445704-64446026 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
54.55 %
Coverage:
78.83 %
Frameshifts:
2
Stop codons:
0


Parental gene:
Parental gene symbol:
RPL28
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein L28 [Source:HGNC Symbol;Acc:10330]

Genomic region (view in browser)





>retro_ecab_721
AACGGGCGCATGTGCAGCGCTGACGCCAATCATCTGGAGGCCCGCAACTCCTTCCGCTAC
AAGGGACTGATTCACTGCGAGGCTGCGGGAGTGGAGCAGGCAGCCGAGGACGAGGGTGTG
GTGGTGTTCACGAAGAGGAGATCCGGCCAGCCAAAGCCAGCCACCTCCATCCTGCAGACC
ACATCAACAAGAACTCCTGGGCCACTTTCAGCGGCACCTGGCACGTGAACATCAAGAACA
AGTACCGCCTGGATCTGCGTGTCTGCCATCCGCTGAGTCTGCGCCAGCCTTGCGCAGCCA
GAAGACTGTGATACTGAAGAGG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.12

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
NKQTYSTEPNNLKARNSFRYNGLIHRKTVGVEPAADGKGVVVVMKRRSGQRKPATSYVRTT-INKNARATLSSIRHMIRRNKYRPDLRMA-AIRRASAIL
N....S...N.L.ARNSFRY.GLIH....GVE.AA...GVVV..KRRSGQ.KPATS...TT.INKN..AT.S...H....NKYR.DLR...........L
Retrocopy
NGRMCSADANHLEARNSFRYKGLIHCEAAGVEQAAEDEGVVVFTKRRSGQPKPATSILQTT/INKNSWATFSGTWHVNIKNKYRLDLRVC/PSAESAPAL


Parental protein
RSQKPVMVKR
RSQK.V..KR
Retrocopy
RSQKTVILKR


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide