RetrogeneDB ID:
retro_ecab_723
Organism:
Horse ( Equus_caballus )
Location:
3:67830700-67831337 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
71.04 %
Coverage:
100.0 %
Frameshifts:
5
Stop codons:
1


Parental gene:
Parental gene symbol:
SGTA
Parental gene aliases:
No gene alias available
Parental gene description:
small glutamine-rich tetratricopeptide repeat (TPR)-containing, alpha [Source:HGNC Symbol;Acc:10819]

Genomic region (view in browser)





>retro_ecab_723
GGAAACAAGCAGAAGAAAGTAAAAAACTTTGAAGCTGCCGTTCCTTTCGAAGGCAAAGCC
GTTAAGCTGATGGCCAGCGCCATGTGTTTCTGTAACAGAGCTGCAATTTACAGCCGACTG
GGGGACTACAGAGGACGGGGCAGGACTGCGAGCAGCCTTCTGCACAGACCCGTCCTACAG
CCAAAGCTACGGCAGGATGGGCCTGGCGCTTTCCAGTCTGAACAAGCACACCGAGGCCTA
CTAGGAGCAGGAGGCCTTGGAGCTGGATCCCGACAACGACAAGTACAAGTCCCACCTCCA
CACAGTGAACCGGAGCTGAGAGAGGCGCGCAGCCCCCGGGAGATGTCCGCAGCTTGGACA
TCGTGGGCCTGCTGAACAACCCAAGCTTCTTGAGCATGGCATCAAACCTAATGAACAATC
CCCAATTCGACAGCTCAGGTCCGGCATGATTTTGGGCAGCCACAACCTCCTGGGGACTCC
AGGCACCAGCCCCTTGCAGAACGAGCTCGCCAGTCTCATCCAGGCGGGTCAGCAGTTCGC
TCAGCAGATGCAGCAGCAGGATCCCGAGTTGATAGAACAGCTCCGAAATCAGATCCGCAG
TCGGATCCCCATTGCCAGCGACGACGACCCGCAGGAA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.05
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.06

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
GNEQMKVENFEAAVHFYGKAIELNPANAVYFCNRAAAYSKLGNYAG-AVQDCER-AICIDPSYSKAYGRMGLALSSLNKHTEAVAYYKKALELDPDNEKY
GN.Q.KV.NFEAAV.F.GKA..L..A.A..FCNRAA.YS.LG.Y.G...QDCE..A.C.DPSYS..YGRMGLALSSLNKHTEA......ALELDPDN.KY
Retrocopy
GNKQKKVKNFEAAVPFEGKAVKLM-ASAMCFCNRAAIYSRLGDYRG/TGQDCEQ/AFCTDPSYSQSYGRMGLALSSLNKHTEAY*E-QEALELDPDNDKY


Parental protein
KSNLKI-AELKLQE-GTSPTGGVGSFDIAGLLNNPSFMSMASNLMNNPQ-VQQLMSGMISGGHNPLGTPGTSPSQNDLASLIQAGQQFAQQMQQQNPELI
KS.L....E..L.E.G..P.G.V.S.DI.GLLNNPSF.SMASNLMNNPQ...QL.SGMI.G.HN.LGTPGTSP.QN.LASLIQAGQQFAQQMQQQ.PELI
Retrocopy
KSHLHT/SEPELRE/GAQPPGDVRSLDIVGLLNNPSFLSMASNLMNNPQ/IRQLRSGMILGSHNLLGTPGTSPLQNELASLIQAGQQFAQQMQQQDPELI


Parental protein
EQLRSQIRSRTPSASNDDQQE
EQLR.QIRSR.P.AS.DD.QE
Retrocopy
EQLRNQIRSRIPIASDDDPQE


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide