RetrogeneDB ID:
retro_ecab_724
Organism:
Horse ( Equus_caballus )
Location:
3:69573864-69575063 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
68.27 %
Coverage:
56.29 %
Frameshifts:
7
Stop codons:
6


Parental gene:
Parental gene symbol:
MAD1L1
Parental gene aliases:
No gene alias available
Parental gene description:
MAD1 mitotic arrest deficient-like 1 (yeast) [Source:HGNC Symbol;Acc:6762]

Genomic region (view in browser)





>retro_ecab_724
GAAGACCTAGGGGAAAACACCACCATCCTAACCATCCTGAGGTCTTTGAACAGCTTCATT
TCTGAGTGAGTAGAGGGAGGGTCTGGATTGGGTGTTTCCATCTCTGTGCAAGTTTCTCTG
CAGATGCAGTACCAGCAGAGCATGCAGTTGGAGGAACCAGCAGAACAGATCCATTCAGTC
TCACCTCACCCAGACAGAGCTGGAAAAGATGCAGATGGAGCTGAGTCACAAGAGGGCTTA
AGTGGGGCTGGAGCAAGTGGCTAGCACCAGTGCTAGGAGCTAAGAACATGAGGTTTACTG
CAACCAAGAGCCCTTGATGTGCATTCTGCAGCTTCAGGAGCAGGAGGCTCAGATGGAGGA
TATTAAGAAGAAGCAGGCAGAGCACAGCAGGTTGTTTAAGCAGCAGCTGGATGCTGCCAG
CAAGAAGCTGCAAGAGAAGGAGGACCACTCAGCTGAAGCCTAAGAAACCATTAGTTTGTC
AAAGGGGAAGATATGGGAATCACAGTGGAATGTGATGAATGCGGAGATGCAGGTGAAGAG
CCTGGAGTCTGACAAGCAGGAGCTGGAGGAGCAGATGGACTTGCAGCACAAAAAAAAATG
CCAGGAAGCTAATCAAAAATTCAGGAACTCCAAGCCAGTCAAGAAGTGAGGGCAAACCAG
GAACAGAGGATTAAGGATTTGAAGCAGAAGCTGTCCTTGCAGGAACAGGATGCTGCCATT
GTGAAGAACATGAAGTCTGAGCTGGTGCAGCTGCCCGAGAGGGAGAGGGAGCTGAACCAT
CTGAGGGAGGAGAACCTGCGGAGATGTGAGAGACCGACAGGCTGCTCAGGGAAGAACTGG
AGGGCCTGCAGGGGTGTTAGGAGAAGATGCAGGGAAATCTCATTGACCTGGAGCTGGAGA
AGACTACTGGAGAAGCTGCAAAGCTGGAAGGGACGGGAGCAGATCACAGGCTTGAACATT
AGGACCCTGAAGACCTTTCCAGTTTCATTGTCCAACTGCAGCAGAGAGAGCTTGCCCTGA
AGGAAGGGAGCAGCTGCAGCACCAGCAGCCCCCCCGGGCCTGGAGAAGTTTAGGCAGCAG
CTCCAGGAGGAAGTCTACCAGGTCTGCAGTCAGCTGCTGGAGGGGAGGAAGAAGCGGAAG
ACCCACGAGGACCTGGCCTGAGACTTCAGAAACGGGTCCTGCTGCTGAAAAAGGTGAGA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
EDLGENTTVLSTLRSLNNFISQRVEGGSGLDVSTSAQGSLQMQYQQSMQLEE-RAEQIRS-KSHLIQMEREKMQMELSHKRARVELERAASTSARSYERE
EDLGENTT.L..LRSLN.FIS..VEGGSGL.VS.S.Q.S...Q.Q........R..Q.RS..SHL.Q.E.EKMQMELSHKRA.V.LE..ASTSARS.E.E
Retrocopy
EDLGENTTILTILRSLNSFISE*VEGGSGLGVSISVQVS--LQMQYQQSMQL\RNQQNRSIQSHLTQTELEKMQMELSHKRA*VGLEQVASTSARS*EHE


Parental protein
VDRNQELLTRIRQLQEREAEVEEKMKEQQERSRLCKQSLDVASKKLREKEDGLAEAGETISALKGRVSELQWSVMNQEMQVRSLESEKQELKEQLDLQHK
V..NQE.L..I.QLQE.EA..E...K.Q.E.SRL.KQ.LD.ASKKL.EKED..AEA.ETIS..KG...E.QW.VMN.EMQV.SLES.KQEL.EQ.DLQH.
Retrocopy
VYCNQEPLMCILQLQEQEAQMEDIKKKQAEHSRLFKQQLDAASKKLQEKEDHSAEA*ETISLSKGKIWESQWNVMNAEMQVKSLESDKQELEEQMDLQHX


Parental protein
KW-QEANQK-IQELQASQEVRADQEQRIKDLEQKLSLQEQDAVIVKNMKSELVRLPKMERELKQLREENVHLR-EMRETNGLLREELEGLRRKLGRQEKM
...QEANQK.IQELQASQEVRA.QEQRIKDL.QKLSLQEQDA.IVKNMKSELV.LP..EREL..LREE...LR.EM.ET..LLREELEGL....G..EKM
Retrocopy
XXCQEANQK/IQELQASQEVRANQEQRIKDLKQKLSLQEQDAAIVKNMKSELVQLPERERELNHLREE--NLR/EM*ETDRLLREELEGLQ---GC*EKM


Parental protein
QENLVDLELEKE-RLLAKLQSWERLDQTTGLSIRT-PEDLSRFIVELQQRELALKDRNSSITCS-ARGLEKVRQQLQEEVRQVSSQLLEERKRRETHEAL
Q.NL.D..LE.E.RLL.KLQSW....Q.TGL.IRT.PEDLS.FIV.LQQRELALK...S..T.S...GLEK.RQQLQEEV.QV.SQLLE.RK.R.THE.L
Retrocopy
QGNLID--LELE\RLLEKLQSWKGREQITGLNIRT/PEDLSSFIVQLQQRELALKEGSSCSTSS\PPGLEKFRQQLQEEVYQVCSQLLEGRKKRKTHEDL


Parental protein
A-RRLQKRVLLLTKER
A..RLQKRVLLL.K.R
Retrocopy
A/LRLQKRVLLLKKVR


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide