RetrogeneDB ID:
retro_ecab_727
Organism:
Horse ( Equus_caballus )
Location:
3:80088056-80088365 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
80.58 %
Coverage:
61.31 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
TPT1
Parental gene aliases:
No gene alias available
Parental gene description:
tumor protein, translationally-controlled 1 [Source:HGNC Symbol;Acc:12022]

Genomic region (view in browser)





>retro_ecab_727
TTAGAATTCATCATGAGCCATCACTTGCAGGAAACCAGCTTCACAAAAGAAGCCTACAAG
AAGTACAACCAAGATTCCATGAACTCAATCAAAGGCAAACTTGAAGAACAGAGACCAGAA
AGAGTAAAACCTTTTGTGACAGGGGCTGCGGAACCAATGAAGCCCATCCTTGCTAATTTC
AAAAACTGCCAGTTCTTTGCTGGTGAAAACATGAATCCAGATGGCATGGCTGCTCTGCTG
GACTGCTGTGTGGATGGTGTAACCCCATATATGATTTTCTTGAAGGATGGTTTAGAAATG
GAAAAATGT

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.07
SRP021940_placental_villous 0.09
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
VDIVMNHHLQETSFTKEAYKKYIKDYMKSIKGKLEEQRPERVKPFMTGAAEQIKHILANFKNYQFFIGENMNPDGMVALLDYREDGVTPYMIFFKDGLEM
....M.HHLQETSFTKEAYKKY..D.M.SIKGKLEEQRPERVKPF.TGAAE..K.ILANFKN.QFF.GENMNPDGM.ALLD...DGVTPYMIF.KDGLEM
Retrocopy
LEFIMSHHLQETSFTKEAYKKYNQDSMNSIKGKLEEQRPERVKPFVTGAAEPMKPILANFKNCQFFAGENMNPDGMAALLDCCVDGVTPYMIFLKDGLEM


Parental protein
EKC
EKC
Retrocopy
EKC


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide