RetrogeneDB ID:
retro_ecab_737
Organism:
Horse ( Equus_caballus )
Location:
3:19496761-19497180 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
69.23 %
Coverage:
53.64 %
Frameshifts:
3
Stop codons:
5


Parental gene:
Parental gene symbol:
EMC3
Parental gene aliases:
No gene alias available
Parental gene description:
ER membrane protein complex subunit 3 [Source:HGNC Symbol;Acc:23999]

Genomic region (view in browser)





>retro_ecab_737
GTGCTCGACTCCAGCAGGAGCCTCTGGGTGGTTTTGCCCATCTTTATCATCACTTCTTTG
CAGGTATGAGCCACCACTGTGGTCCACAGTGCTGCAGAGTGACAAGAAGCTCACCCGGGA
GCAGGTATCTGACAGTTAAGTCTTAATTTGAAGCATAGTCCTCAGGGAAAATGCAAATTA
TATTCCCAAATAGTTCTTCTTGACATGAAAATATTGCTTCAACAACCCAGAGGATAGATT
TTTCAAAAAAAAATGAAGCAAAAATAGTACGAACTTCTCCTATGACTGATCCCACTATGC
TCACTGACATGATAAAAGGGAGTGTACCAATCTTCCTCCCTATGATTCTTATTGGTGGAT
AGATCAACACGATATTCTCGGGCTTTGTCACAACCAAAGTCCTATTTCCAATGACCCTG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.12
SRP021940_cerebellum 0.45
SRP021940_embryo 0.55
SRP021940_placental_villous 0.36
SRP021940_synovial_membrane 0.52
SRP021940_testis 0.47

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
LLDSNIRLWVVLPIVIIT-FFVGMIRH-YVSILLQSDKKLTQEQVSDSQVLIRSRVLRENGKYIPKQSFLTRKYYFNNPEDGFFKKT-KRKVVPPSPMTD
.LDS...LWVVLPI.IIT.FF.GM..H...S..LQSDKKLT.EQVSDS.VLI.S.VLREN..YIPK..FLT.KY.FNNPED.FF......K.V..SPMTD
Retrocopy
VLDSSRSLWVVLPIFIIT/FFAGMSHH/LWSTVLQSDKKLTREQVSDS*VLI*SIVLRENANYIPK*FFLT*KYCFNNPEDRFFXXX\EAKIVRTSPMTD


Parental protein
PTMLTDMMKGNVTNVLPMILIGGWINMTFSGFVTTKVPFPLTL
PTMLTDM.KG.V...LPMILIGG.IN..FSGFVTTKV.FP.TL
Retrocopy
PTMLTDMIKGSVPIFLPMILIGG*INTIFSGFVTTKVLFPMTL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide