RetrogeneDB ID:
retro_ecab_739
Organism:
Horse ( Equus_caballus )
Location:
3:40366473-40367844 (-)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
88.29 %
Coverage:
87.74 %
Frameshifts:
3
Stop codons:
0


Parental gene:
Parental gene symbol:
GSPT1
Parental gene aliases:
No gene alias available
Parental gene description:
G1 to S phase transition 1 [Source:HGNC Symbol;Acc:4621]

Genomic region (view in browser)





>retro_ecab_739
CACCCGGAGGAAAGTGCCCAAGAAACGATGGAGGAGGAAGAGGAAATACCAAAACCTAAC
TCTGTGGTTGCACCGCCAGGTGTGCCTAAAAAAGAACATGTACATGTAGTATTCATTGGG
CGTGCAGATGTTGGCGAGTCAACCATGGGAGGACAAATAATGTCTTTGACTGGAATGCTT
GACAAAAGACCTCTTGAGAAAGATGAAGGAGAAGCTAAAGAAAAACCGGGGAAACTTGGT
ACTTGTCTTGGGCCTTAGACACAAATCAGGAAGAACGAGACAAGGGTAAAACAGTAGAAG
TGGGCCGTGCCTATTTTGAAACAGAAAAGAAGCATTTCGCAATTCTAGATGGCCCTGGCC
ACAAGAGTTTTGTCCCAGATATGATTGGTGGTGCTTCTCAAGCTGATTTGGCTGTGTTGG
TAATCTCTGCCAGGAAAGGAGAGTTTGAAACTAGATTTGAAAAAGGAGGGCAGAAAAGAG
AACATGCATTGTTGGCAAAGACAGCAGGGGTAAAACACTTAATTGTGCTGATCAATAAGA
TGGATGATCCAACAGTAAACTGAGCAAGGAGAGATATGAAGAATGTAAAGAGAAACTAGT
GCCATTTTTGAAAAAAGTTGTCTTCAATCCCAAAAGGCACGTTCACTTTATGCCTGCTCA
GGACTGACTGGAGCAAATGTTAAAGAGCAACCAGACTTCTGTCCTTGGTACATTGGATTA
CCATTTATTCCATATCTGGATAATTTGCCGAACTTCAATAGATCAGTTGATAGACCAATC
AGGCTGCCAATTATGGATAAATACAAGGATATGGGCACTGTGGTGCTGGGAAAGCTGGGA
TCAGGATCTGCTTGCAAAGGCCAGCAGCTTGCAATGATGCCAAATAAGCACAATGTGGAA
GTTCTTGGAATCCTTTCCAACGATGTAGAAACGGATTCTGTAGCCCCAGGTGAAAACCTC
AAAATGAGACCGAAAGGAACTGAAGAAGAGGAGACTCTTCCAGGATTCATACTTTGTGAT
CCTAACAGTCTTTGTCATTCTGGACGCACATTTGATGCCCAGATAGTGATTATAGAGCAC
AAATCCATCATCTGCCCAGGTTATAATGCGGTGCTGCGTATTCACACCTGTGTTGAAGAA
GTCGAAACAACAGCCTTAATCTGCTTGGTATACAAAAAATCAGGAGAAAAAAGTAAGACT
TGGCCCCGTTTTGTGAAACAAGATCAAGCACGCATTGCTCGCTTAAGGACAGCAGGAACC
AACTGCCTGGAGACCTTTAAAGACTTCCCTCAGATGGGTCGTCTTACCTTACGAGATGAG
GGTAAGACCATTGCAATTGGAAAAGTTCTGAAACTGGTTCCAGAGAAAGAC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.23
SRP021940_cerebellum 0.0
SRP021940_embryo 0.12
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.47
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
HPEESAQEMMEEEEEMPKPKSVVAPPGAPKKEHVNVVFIGHVDAGKSTIGGQIMYLTGMVDKRTLEKYEREAKEK-NRETWYLSWALDTNQEERDKGKTV
HPEESAQE.MEEEEE.PKP.SVVAPPG.PKKEHV.VVFIG..D.G.ST.GGQIM.LTGM.DKR.LEK.E.EAKEK...ETWYLSWALDTNQEERDKGKTV
Retrocopy
HPEESAQETMEEEEEIPKPNSVVAPPGVPKKEHVHVVFIGRADVGESTMGGQIMSLTGMLDKRPLEKDEGEAKEK/TGETWYLSWALDTNQEERDKGKTV


Parental protein
EVGRAYFETEKKHFTILDAPGHKSFVPNMIGGASQADLAVLVISARKGEFETGFEKGGQTREHAMLAKTAGVKHLIVLINKMDDPTVN-WSNERYEECKE
EVGRAYFETEKKHF.ILD.PGHKSFVP.MIGGASQADLAVLVISARKGEFET.FEKGGQ.REHA.LAKTAGVKHLIVLINKMDDPTVN..S.ERYEECKE
Retrocopy
EVGRAYFETEKKHFAILDGPGHKSFVPDMIGGASQADLAVLVISARKGEFETRFEKGGQKREHALLAKTAGVKHLIVLINKMDDPTVN/LSKERYEECKE


Parental protein
KLVPFLKKVGFNPKKDIHFMP-CSGLTGANLKEQSDFCPWYIGLPFIPYLDNLPNFNRSVDGPIRLPIVDKYKDMGTVVLGKLESGSICKGQQLVMMPNK
KLVPFLKKV.FNPK...HFMP.CSGLTGAN.KEQ.DFCPWYIGLPFIPYLDNLPNFNRSVD.PIRLPI.DKYKDMGTVVLGKL.SGS.CKGQQL.MMPNK
Retrocopy
KLVPFLKKVVFNPKRHVHFMP/CSGLTGANVKEQPDFCPWYIGLPFIPYLDNLPNFNRSVDRPIRLPIMDKYKDMGTVVLGKLGSGSACKGQQLAMMPNK


Parental protein
HNVEVLGILSDDVETDSVAPGENLKIRLKGIEEEEILPGFILCDPNNLCHSGRTFDAQIVIIEHKSIICPGYNAVLHIHTCIEEVEITALICLVDKKSGE
HNVEVLGILS.DVETDSVAPGENLK.R.KG.EEEE.LPGFILCDPN.LCHSGRTFDAQIVIIEHKSIICPGYNAVL.IHTC.EEVE.TALICLV.KKSGE
Retrocopy
HNVEVLGILSNDVETDSVAPGENLKMRPKGTEEEETLPGFILCDPNSLCHSGRTFDAQIVIIEHKSIICPGYNAVLRIHTCVEEVETTALICLVYKKSGE


Parental protein
KSKTRPRFVKQDQVCIARLRTAGTICLETFKDFPQMGRFTLRDEGKTIAIGKVLKLVPEKD
KSKT.PRFVKQDQ..IARLRTAGT.CLETFKDFPQMGR.TLRDEGKTIAIGKVLKLVPEKD
Retrocopy
KSKTWPRFVKQDQARIARLRTAGTNCLETFKDFPQMGRLTLRDEGKTIAIGKVLKLVPEKD


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide