RetrogeneDB ID:
retro_ecab_74
Organism:
Horse ( Equus_caballus )
Location:
5:97752004-97752967 (-)
Status:
KNOWN_PROTEIN_CODING
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
76.8 %
Coverage:
85.25 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
HCP-1
Parental gene aliases:
No gene alias available
Parental gene description:
heterogeneous nuclear ribonucleoprotein A1 [Source:RefSeq peptide;Acc:NP_001229438]

Genomic region (view in browser)





>retro_ecab_74
ATGTCTAAGTCAGAGTCTCCCAAAGAGCCCGAACAGCTGCGGAAGCTCTTCATCAGAGGT
TTGAGTTTTGAAACAACTGATGAGAGTCTCAGGAGCCATTCTGAGCAACGGAGAACGCTC
ACGGACTGTGTGGTAATGAGAGATCCAAACACCAAGTGCTCCAGAGGCTTTGGCTTTGTC
ACGTACGCCACTGTGGAGGAGGTGGATGCAGCTATGAATGCAAGGCCACACAAGGTAGAT
GGAAGAGTTGTGGAACCAAAGAGGGCCGTCTTAAGAGAAGATTCTCAAAGACTTGGTGCC
CACTTAACTGTGAAAAAGCTTTTTGTTGGTGGCATTAAAGAAGACACTGAAGAACATCAC
CTAAGAGATTATTTTGAACAGTATGGGAAAATTGAAGTGATTGAAATCATGACTGACAGA
GGCAGTGGCAAGAAGAGAGGATTTGCTTTTCTAACTTTTGATGACCATGACTCCGTAGAC
AAGTCTGTTATTCAGAAATACCATACTGTGAATGGCCACAACTGTGAAGTAAGGAAAGCC
CTATCTAAGCAAGAGATGGCTAGTGCTTCATCCAGTCAAAGAGGTCAAAGTGGTTCTGGA
AATTTTGGTGGTGGTCGTGGAGGTGGTTTTGGTGGGAATGACAACTTTGGTTGTGGAGGA
AACTCAGTGGTTGAGTTAGCTTCGGTGGCAGCCGTGGCAGGTGGTGGATATGGTGGCAGT
GGGGATGGCTATAATGGATTTGGTAATGATGGAAGCAATTTTGGAGGTGGAGGAAGCTAT
AATGATTTTGGAAATTACAACAATCAATCTTCAAATTTTGGACCCATGAAAGGAGGAAAT
TTTGGAGGCAGATGCTCTGGCCCCTATGGTGGTGGAGGCCAATACTTTGCCAGACCACGA
AACCAAGGTGGCTATGGCGGTTCCAGCAGCAGCAGTAGCTATGGCAGTGGCAGAAGGTTT
TAA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.06
SRP021940_cerebellum 0.2
SRP021940_embryo 21.13
SRP021940_placental_villous 4.7
SRP021940_synovial_membrane 4.4
SRP021940_testis 2.02

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGA
MSKSESPKEPEQLRKLFI.GLSFETTDESLRSH.EQ..TLTDCVVMRDPNTK.SRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAV.REDSQR.GA
Retrocopy
MSKSESPKEPEQLRKLFIRGLSFETTDESLRSHSEQRRTLTDCVVMRDPNTKCSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVLREDSQRLGA


Parental protein
HLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGRSGSG
HLTVKK.FVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAF.TFDDHDSVDK.VIQKYHTVNGHNCEVRKALSKQEMASASSSQRG.SGSG
Retrocopy
HLTVKKLFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFLTFDDHDSVDKSVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGQSGSG


Parental protein
NFGGGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGGGYGGSGDGYNGFGNDGGYGGGGPGYSGGSRGYGSGGQGYGNQGSGYGGSGSYDSYNNGGGGGGFG
NFGGGRGGGFGGNDNFG.GGN............GGGYGGSGDGYNGFGNDG...GGG..Y......Y.......G....G..G......Y..GGGG..F.
Retrocopy
NFGGGRGGGFGGNDNFGCGGNSVVELASVAAVAGGGYGGSGDGYNGFGNDGSNFGGGGSYNDFG-NYNNQSSNFGPMKGGNFGGRCSGPY--GGGGQYFA


Parental protein
-GGSGSNFGGGGSYNDFGN
........GG..S....G.
Retrocopy
RPRNQGGYGGSSSSSSYGS


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide