RetrogeneDB ID:
retro_ecab_740
Organism:
Horse ( Equus_caballus )
Location:
3:57378401-57379624 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
96.82 %
Coverage:
100.0 %
Frameshifts:
1
Stop codons:
1


Parental gene:
Parental gene symbol:
ETF1
Parental gene aliases:
No gene alias available
Parental gene description:
eukaryotic translation termination factor 1 [Source:HGNC Symbol;Acc:3477]

Genomic region (view in browser)





>retro_ecab_740
AATGGCACAAGCATGATATCATTGATCATTCCTCCCAAAGACCAGATTTCAAGAGTGGCA
AAAATGTTAGCAGATGAGTTTGGAAGTGCATCTAACATTAAATCACGTGTAAACCGCCTT
TCAGTCTTGGGAGCCATTACATCTGTACAGCAAAGACTCAAACGTTGTAACAAAGTACCT
CCAAATGGACTGGTTGTTTACTGTGGTACAATTGTAACAGAAGAAGGAAAGGAAAAGAAA
GTCAACATTGACTTTGAACCTTTCAAACCAGTTAATACGTCGTTGTATTTGTGCGACAAC
AAATTCCATACAGAGGCTCTTACAGCACTACTTTCAGATGATAGCAAGTTTGGCTTCATT
GTAATAGATGGTAGTGGTGCACTTTTTGGCACACTCCAAGGAAAGACAAGAGAAGTCCTG
CACAAATTCACTGTGGATCTCCCAAAGAAACATGGTAGAGGAGGTCAATCAGCCTTGCGT
TTTGCCTGTTTAAGAATGGAAAAGTGACATAACTATGTTTGGAAAGTAGCTGAGACTGCT
GTACAGCTCATTATTTCAGGGGACAAAGTAAATGTGGCTGGTCTCGTTTTAGCTGGATCA
GCTGACTTTAAAACTGAACTAAGTCAATCTGATATGTTTGATCAGAGGTTGCAATCAAAA
GTTTTAAAATTAGTTGATATATCCTATGGTGGTGAAAATGGATTCAACCAAGCTATTGAG
TTATCTACTGAAGTCCTGTCCAACGTGAATTCATTCAAGAGAAGAAATTAATAGGGCGGT
ACTTTGATGAAATCAGCCAGGACACGGGCAAGTACTGTTTTGGAGTTGAAGATACACTAA
AGGCTTTAGAAATGGGAGCTGTAGAGATCCTAATAGTCTATGAAAATCTGCGTATAATGA
GATATGTTCTTCATTGCCAAGGCACGGAAGAGGAGAAAATTCTCTACCTAACTCCAGAAC
AAGAGAAGGATAAATCTCATTTCACAGACAAAGAGACAGGACAAGAACATGAGCTGATTG
AGAGCATGCCCCTGCTGGAATGGTTTGCTAACAACTATAAAAAATTTGAAGCTACGTTGG
AAATTGTCACTGATAAGTCACAAGAAGGATCCCAGTTTGTGAAAGGATTTGGTGGAATTG
GAGGTATCTTGCGGTACCGAGTAGATTTCCAGGGAATGGAATACCAAGGAGGAGACGATG
AATTTTTTGACCTTGATGACTAC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.52
SRP021940_cerebellum 0.35
SRP021940_embryo 0.89
SRP021940_placental_villous 0.98
SRP021940_synovial_membrane 0.52
SRP021940_testis 0.59

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
NGTSMISLIIPPKDQISRVAKMLADEFGTASNIKSRVNRLSVLGAITSVQQRLKLYNKVPPNGLVVYCGTIVTEEGKEKKVNIDFEPFKPINTSLYLCDN
NGTSMISLIIPPKDQISRVAKMLADEFG.ASNIKSRVNRLSVLGAITSVQQRLK..NKVPPNGLVVYCGTIVTEEGKEKKVNIDFEPFKP.NTSLYLCDN
Retrocopy
NGTSMISLIIPPKDQISRVAKMLADEFGSASNIKSRVNRLSVLGAITSVQQRLKRCNKVPPNGLVVYCGTIVTEEGKEKKVNIDFEPFKPVNTSLYLCDN


Parental protein
KFHTEALTALLSDDSKFGFIVIDGSGALFGTLQGNTREVLHKFTVDLPKKHGRGGQSALRFARLRMEKRHNYVRKVAETAVQLFISGDKVNVAGLVLAGS
KFHTEALTALLSDDSKFGFIVIDGSGALFGTLQG.TREVLHKFTVDLPKKHGRGGQSALRFA.LRMEK.HNYV.KVAETAVQL.ISGDKVNVAGLVLAGS
Retrocopy
KFHTEALTALLSDDSKFGFIVIDGSGALFGTLQGKTREVLHKFTVDLPKKHGRGGQSALRFACLRMEK*HNYVWKVAETAVQLIISGDKVNVAGLVLAGS


Parental protein
ADFKTELSQSDMFDQRLQSKVLKLVDISYGGENGFNQAIELSTEVLSNV-KFIQEKKLIGRYFDEISQDTGKYCFGVEDTLKALEMGAVEILIVYENLDI
ADFKTELSQSDMFDQRLQSKVLKLVDISYGGENGFNQAIELSTEVLSNV..FIQEKKLIGRYFDEISQDTGKYCFGVEDTLKALEMGAVEILIVYENL.I
Retrocopy
ADFKTELSQSDMFDQRLQSKVLKLVDISYGGENGFNQAIELSTEVLSNV/EFIQEKKLIGRYFDEISQDTGKYCFGVEDTLKALEMGAVEILIVYENLRI


Parental protein
MRYVLHCQGTEEEKILYLTPEQEKDKSHFTDKETGQEHELIESMPLLEWFANNYKKFGATLEIVTDKSQEGSQFVKGFGGIGGILRYRVDFQGMEYQGGD
MRYVLHCQGTEEEKILYLTPEQEKDKSHFTDKETGQEHELIESMPLLEWFANNYKKF.ATLEIVTDKSQEGSQFVKGFGGIGGILRYRVDFQGMEYQGGD
Retrocopy
MRYVLHCQGTEEEKILYLTPEQEKDKSHFTDKETGQEHELIESMPLLEWFANNYKKFEATLEIVTDKSQEGSQFVKGFGGIGGILRYRVDFQGMEYQGGD


Parental protein
DEFFDLDDY
DEFFDLDDY
Retrocopy
DEFFDLDDY


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide