RetrogeneDB ID:
retro_ecab_747
Organism:
Horse ( Equus_caballus )
Location:
3:97903647-97904457 (-)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
88.41 %
Coverage:
89.47 %
Frameshifts:
4
Stop codons:
0


Parental gene:
Parental gene symbol:
UNG
Parental gene aliases:
No gene alias available
Parental gene description:
uracil-DNA glycosylase [Source:HGNC Symbol;Acc:12572]

Genomic region (view in browser)





>retro_ecab_747
CATGCGACGGCCAGCCCAGCCAAGAAGGCTCGAGCCGGGCAGGAGGACCCCGGCACGCCG
CCCTCCTCGCCGCTGAGCCCGGAGCAGCTGGACCGCATCCAGAGGAACATGGCCGCGGCC
CTGCGCAGACTCGCGGCGCGCAATGTGCCCGTGGGTTTCGGCGAGAGTTGGAAGAGGCAC
CTCAGCGGAGGGTTCGGCAAACCGTATTTTATAAAGCTAATGGGGTTCGTTGCAGAAGAA
AGAAGACATCACACTGTTTATCCACCCCCACACCAAGTCGTGGACCCAAATGTGTGACCT
AAGAGATGTAAAGGTCGTCATCCTGGGCCTGGATCCGTATCACGGACCCAATCCAGCTCA
CGGGTTCTGCTTCAGTGTTCAAAGACCGGTTCCACCTCCCCCCAAGCTTGGAAAACGTTT
ATAAGGAGCTGTCCACAGACATAGACGGTTTTGTTCATCCTGGTCATGGAGATTTATCTG
CGTGGGCCAAACAAGGTGTTCTCCTACTCAACGCTGTCCTCACGGTCCGGGAGCATCAGG
CCAGTTCTCACAAGGAGAGAGGCTGGGAGGAGTTCACCGACCGGTCGTGTCCTGGCTAAA
TCAGGCCTCAAATGGCCTCGTGTTCCTGCTCTGGGGCTCTTATGCTCAGAAGAAGGGCAT
TGCCATCGACAGGAAGCGGCCCCATGTGCTGCAGACTGCTCACCCTCCCCGTTCTCCGTG
AACAGAGGCTTCTTTGGGTGTAGACATTTCTCTAAGACAAATGAGCTGCTGCAGAAGTCC
GGCAAGGAGCCCATCGACTGGAAGGAGCTG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.07
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.03
SRP021940_testis 0.59

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
HLQASPAKKARAGQEDPGTPPSSPLSPEQLDRIQRNKAAALLRLAARNVPVGFGESWKKHLSGEFGKPYFIKLMGFVAEERRHH-TVYPPPHQVFTWTQM
H..ASPAKKARAGQEDPGTPPSSPLSPEQLDRIQRN.AAAL.RLAARNVPVGFGESWK.HLSG.FGKPYFIKLMGFVAEERR.H.T....PH....WTQM
Retrocopy
HATASPAKKARAGQEDPGTPPSSPLSPEQLDRIQRNMAAALRRLAARNVPVGFGESWKRHLSGGFGKPYFIKLMGFVAEERR-H\TLFIHPHTK-SWTQM


Parental protein
CDIRDVKVVILGQDPYHGPSQAHGLCFSVQRPVPPPP-SLENIYKELSTDIDGFVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSHKERGWEEFTD-AV
CD.RDVKVVILG.DPYHGP..AHG.CFSVQRPVPPPP.SLEN.YKELSTDIDGFVHPGHGDLS.WAKQGVLLLNAVLTVR.HQA.SHKERGWEEFTD..V
Retrocopy
CDLRDVKVVILGLDPYHGPNPAHGFCFSVQRPVPPPP\SLENVYKELSTDIDGFVHPGHGDLSAWAKQGVLLLNAVLTVREHQASSHKERGWEEFTD/PV


Parental protein
VSWLNHNSNGLVFLLWGSYAQKKGIAIDRKRHHVLQTAH-PSPFSVNRGFFGCRHFSKTNELLQKSGKEPIDWKEL
VSWLN..SNGLVFLLWGSYAQKKGIAIDRKR.HVLQTAH.PSPFSVNRGFFGCRHFSKTNELLQKSGKEPIDWKEL
Retrocopy
VSWLNQASNGLVFLLWGSYAQKKGIAIDRKRPHVLQTAH/PSPFSVNRGFFGCRHFSKTNELLQKSGKEPIDWKEL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide