RetrogeneDB ID:
retro_ecab_749
Organism:
Horse ( Equus_caballus )
Location:
30:616681-617648 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
82.67 %
Coverage:
72.91 %
Frameshifts:
3
Stop codons:
1


Parental gene:
Parental gene symbol:
ABI1
Parental gene aliases:
No gene alias available
Parental gene description:
abl-interactor 1 [Source:HGNC Symbol;Acc:11320]

Genomic region (view in browser)





>retro_ecab_749
AAGCATGGAAATAACCAGCCTGCAAGAACTGGCACTCTGTCGAGAACAAATCCTCCTACT
CAGAAGCCACCGAGTCCTCCCACGTCAGGCCGGGGACGCTGGGGCGGAATACTCCTTACA
AAACCCTGGAGCCTGTTAAACCCCACCGTTCCTAGTGACTACATGACAAGTCCTGCTACG
CTCGGAAGTCAGCATAGCCCAGGCAGGACAGCTTCTTTAAATCAGAGACCGAGGACACAC
AGTGGAAGCAGTGGAGGAAGTGGAAGTCGAGAAAACAGTGGAAGCAGCAGTATTGGCATT
CCCACTGCCGTGCCTACACCCTCAGCACCCGCTGTTGGACCAGCCGCCCGCGGCTCAGCT
CCTGGTTCCCAGTACGGCACAATGACCAGGCAGATCTCTCAACACAACTCTACCACTTCC
TCGACATCTTCTGCTGCATACAGACGAACTCCGTCTGTGACTGCTCAATTTTCTGCTCAG
CCTCATGTTAATGGAGGTCCACTTTATTCTCAAAATTCAATTTCTATTGCTCCACCCCCT
CCCCGTACGCCTCAGTTGACTCCACAGATACCTCTCATAGGCTTCGTGGCCTGGGGGCAG
GAAAACATTGCTGATAGTCCAACTCCACCCCCACCCACCTCCACCAGATGACATTCCCAT
GTTTGATGACTCTTCACCTCCACAGCACCACCTCCAGTGGATTATGAAGACAAGGAGGCT
GCAGTGGTTCAGTATAATGATCCAAATGCAGATGGGGATCCTGCTTGGGCCCGCAAGAAT
TATATTGAGAAAGTTGTGGCAATATATGGTTATACAAAAGACAAAGATGATGAGCTATCA
TTTATGGAGAGTACAATCATTTGTGTAATAAAGAAGAATGATGACGACTGGTATGAAGGA
GTCTGCAATCAGAGTGACTGGTCTGTTCCCTGGGAACTATGTCACATCAATCATGTACTA
GACTGAT

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.23
SRP021940_cerebellum 0.0
SRP021940_embryo 0.26
SRP021940_placental_villous 0.18
SRP021940_synovial_membrane 0.34
SRP021940_testis 0.3

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
KHGNNQPARTGTLSRTNPPTQK---PPSPPMSGRGTLGRNTPYKTLEPVKPPTVPNDYMTSPARLGSQHSPGRTASLNQRPRTHSGSSGGSGSRENSGSS
KHGNNQPARTGTLSRTNPPTQK...PP.......G......P...L.....PTVP.DYMTSPA.LGSQHSPGRTASLNQRPRTHSGSSGGSGSRENSGSS
Retrocopy
KHGNNQPARTGTLSRTNPPTQKPPSPPTSGRGRWGGILLTKPWSLLN----PTVPSDYMTSPATLGSQHSPGRTASLNQRPRTHSGSSGGSGSRENSGSS


Parental protein
SIGIPIAVPTPSPPTIGPAAPGSAPGSQYGTMSRQISRHNSTTSSTSSGGYRRTPSVTAQFSAQPHVNGGPLYSQNSISIAPPPPPMPQLTPQIPLTGFV
SIGIP.AVPTPS.P..GPAA.GSAPGSQYGTM.RQIS.HNSTTSSTSS..YRRTPSVTAQFSAQPHVNGGPLYSQNSISIAPPPP..PQLTPQIPL.GFV
Retrocopy
SIGIPTAVPTPSAPAVGPAARGSAPGSQYGTMTRQISQHNSTTSSTSSAAYRRTPSVTAQFSAQPHVNGGPLYSQNSISIAPPPPRTPQLTPQIPLIGFV


Parental protein
ARVQENIADSPTPPP-PPPPDDIPMFDDSPPP-PPPPPVDYEDEEAAVVQYNDPYADGDPAWAPKNYIEKVVAIYDYTKDKDDELSFMEGAIIYVIKKND
A..QENIADSPTPPP.PPPPDDIPMFDDS.PP...PPPVDYED.EAAVVQYNDP.ADGDPAWA.KNYIEKVVAIY.YTKDKDDELSFME..II.VIKKND
Retrocopy
AWGQENIADSPTPPP\PPPPDDIPMFDDSSPP/TAPPPVDYEDKEAAVVQYNDPNADGDPAWARKNYIEKVVAIYGYTKDKDDELSFMESTIICVIKKND


Parental protein
DGWYEGVCN-RVTGLFPGNYVESIMHYTD
D.WYEGVCN.RVTGLFPGNYV.SIM..TD
Retrocopy
DDWYEGVCN\RVTGLFPGNYVTSIMY*TD


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide